Anolis carolinensis (green anole): 100566553 Help Entry 100566553         CDS       T01608                                  Symbol rbx1 Name (RefSeq) ring-box 1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism acs  Anolis carolinensis (green anole) Pathway acs03420   Nucleotide excision repair acs04110   Cell cycle acs04114   Oocyte meiosis acs04120   Ubiquitin mediated proteolysis acs04141   Protein processing in endoplasmic reticulum acs04310   Wnt signaling pathway acs04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:acs00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     100566553 (rbx1)    04120 Ubiquitin mediated proteolysis     100566553 (rbx1)   09124 Replication and repair    03420 Nucleotide excision repair     100566553 (rbx1)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     100566553 (rbx1)    04350 TGF-beta signaling pathway     100566553 (rbx1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:acs04121]     100566553 (rbx1)    03400 DNA repair and recombination proteins [BR:acs03400]     100566553 (rbx1) Enzymes [BR:acs01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      100566553 (rbx1) Ubiquitin system [BR:acs04121]  Ubiquitin ligases (E3)   UBL E3 ligases    100566553 (rbx1)   Multi subunit type E3    SCF complex     Ring finger protein      100566553 (rbx1)    Cul2 complex      100566553 (rbx1)    Cul3 complex      100566553 (rbx1)    Cul4 complex      100566553 (rbx1)    Cul7 complex      100566553 (rbx1)    Cul8 complex      100566553 (rbx1)    Cul9 complex      100566553 (rbx1) DNA repair and recombination proteins [BR:acs03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       100566553 (rbx1)     TCR (transcription coupled repair) factors      Cul4-CSA complex       100566553 (rbx1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  100566553 NCBI-ProteinID:  XP_003221035 Ensembl:  ENSACAG00000005208 UniProt:  G1KDQ9 LinkDB All DBs Position 5:26051840..26056647 Genome browser AA seq 108 aa AA seqDB search MAAAMDVDTPSGTNSNAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggctgccgcgatggatgttgacacaccaagcgggaccaacagcaatgccggcaaaaag cgtttcgaagtgaaaaagtggaatgcagttgcactctgggcttgggacatcgtggttgat aattgtgccatttgcagaaaccacattatggatctgtgcatagaatgtcaagctaaccaa gcatcagctacctctgaagaatgcactgttgcgtggggtgtctgtaatcacgcttttcat tttcattgtatttctcgctggcttaagactcggcaggtttgccccttggacaatcgagaa tgggaattccagaagtatggacactag

DBGET integrated database retrieval system