Athene cunicularia (burrowing owl): 113491294 Help Entry 113491294         CDS       T05777                                  Symbol IFNG Name (RefSeq) interferon gamma   KO K04687   interferon gamma Organism acun  Athene cunicularia (burrowing owl) Pathway acun03050   Proteasome acun04060   Cytokine-cytokine receptor interaction acun04217   Necroptosis acun04350   TGF-beta signaling pathway acun05164   Influenza A acun05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:acun00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     113491294 (IFNG)  09130 Environmental Information Processing   09132 Signal transduction    04350 TGF-beta signaling pathway     113491294 (IFNG)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     113491294 (IFNG)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     113491294 (IFNG)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     113491294 (IFNG)    05168 Herpes simplex virus 1 infection     113491294 (IFNG)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03051 Proteasome [BR:acun03051]     113491294 (IFNG)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:acun04052]     113491294 (IFNG)    00536 Glycosaminoglycan binding proteins [BR:acun00536]     113491294 (IFNG) Proteasome [BR:acun03051]  Eukaryotic proteasome   Assembling factors    Other assembling factors     113491294 (IFNG) Cytokines and neuropeptides [BR:acun04052]  Cytokines   Interferons    113491294 (IFNG) Glycosaminoglycan binding proteins [BR:acun00536]  Heparan sulfate / Heparin   Cytokines    113491294 (IFNG) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IFN-gamma ATG17_like DUF4422 DUF948 Motif Other DBs NCBI-GeneID:  113491294 NCBI-ProteinID:  XP_026723894 UniProt:  A0A663MQC7 LinkDB All DBs Position 1 AA seq 165 aa AA seqDB search MTCQTYSLFVLSVIMIYFGRFGDSLILAQLQNDIDQLKADFNSSHSDVADGGPIFTDKLI NWTERNEKRIILSQIVSMYLEMLEKTDTSKAHVRHISEELYTLKRSLPDGLKKMNDLMDL TKLQMSDLKIQRKAVNELFSVLQKLVETSTSLKRKRSQSQRRCKC NT seq 498 nt NT seq  +upstreamnt  +downstreamnt atgacttgccagacctacagcttgtttgttctgtctgtcatcatgatttattttggacgt tttggagatagcttaattcttgctcaacttcaaaatgatatagaccaactgaaagctgac tttaactcaagtcattcagacgtggctgatggtggacctatttttacggacaaactgata aattggacagagagaaatgaaaaaaggatcatcctgagccagattgtttccatgtacttg gaaatgcttgaaaagaccgacacgtcaaaggcacatgtcaggcacatctctgaggagctc tatactctgaaaagaagccttcctgatggcttaaagaagatgaatgacctcatggacctg acaaagcttcagatgagtgacttgaaaattcaacgcaaagctgtgaatgagctgttcagt gtcttacaaaaactggtggagacttcaacttctctcaaaaggaaaagaagccagtctcag aggaggtgcaaatgctaa

DBGET integrated database retrieval system