KEGG   Azotobacter chroococcum: Achr_1090
Entry
Achr_1090         CDS       T03640                                 
Name
(GenBank) Methionyl-tRNA Fmet Formyltransferase Chain A domain 2
  KO
K00604  methionyl-tRNA formyltransferase [EC:2.1.2.9]
Organism
acx  Azotobacter chroococcum
Pathway
acx00670  One carbon pool by folate
acx00970  Aminoacyl-tRNA biosynthesis
acx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acx00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Achr_1090
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Achr_1090
Enzymes [BR:acx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.9  methionyl-tRNA formyltransferase
     Achr_1090
SSDB
Motif
Pfam: Formyl_trans_N Formyl_trans_C
Other DBs
NCBI-ProteinID: AJE19623
UniProt: A0A0C4WFR0
LinkDB
Position
123849..124793
AA seq 314 aa
MTQPLRIVFAGTPEFAAEHLKALLAAGQRPIAVYTQPDRPAGRGQKLMPSPVKQLALQHA
IPVLQPSSLRDPAAQAELAALEPDLLLVVAYGLILPQAVLDIPRLGCINSHASLLPRWRG
AAPIQRAIEAGDGESGVTVMQMEAGLDTGPMLLKVATPIQPDDTGGSLHDRLAGLGAQAL
VEAVARLAAGELAGEVQDDALATYAHKLNKDEARLDWSRPADELARRIRAFDPWPVCHSS
LNGTPLKVFGALVEAGEGAPGTILAARRDGLTVACGSGALRLTRLQLPGGKPLAFAELYH
SRREQFAVGQVLGT
NT seq 945 nt   +upstreamnt  +downstreamnt
atgacccagcctttgcgcatcgtcttcgccggcacgcccgaattcgccgccgaacacctc
aaggccctgctggccgccggccagcggccgatcgccgtctacacccagccggatcgcccc
gccggacgcgggcagaagctgatgcccagtccggtgaagcagctcgccctgcagcacgcc
atccccgtcctgcagccttcgagcctgcgcgatcccgccgcccaggcggagctggcggcg
ctcgaacccgacctcctgctggtggtcgcctacgggctgatcctgccgcaggcggtgctg
gacatcccgcgcctcggctgcatcaacagccacgcctcgctgctgccgcgctggcgcggc
gcagcgccgatccagcgcgccatcgaggccggcgacggcgaatccggggtcaccgtgatg
cagatggaagcaggtctggacaccgggccgatgctgctcaaggtcgccacgccgatccag
cccgacgacaccggcggcagcctgcacgaccgcctggccgggctgggtgcgcaggccctg
gtcgaggccgtcgccaggctggccgccggcgaactcgccggcgaggtgcaggacgacgcc
ctggccacctacgcgcacaagctgaacaaggacgaggcacgcctcgactggagccgcccg
gcagacgagctggcgcggcggatccgcgccttcgatccctggccggtctgccacagcagc
ctgaacggcacgccgctgaaggtgttcggcgcgctcgtcgaggcgggcgagggggcgccg
ggaaccatcctcgccgcccgccgcgacggcctgaccgtcgcctgcggcagcggcgccctg
cgcctgacccgcctgcagctgccgggtggcaagccgctggccttcgccgagctgtaccac
agccgccgcgagcagttcgccgtcggccaggtgctggggacatga

DBGET integrated database retrieval system