Anser cygnoides (swan goose): 125184485 Help Entry 125184485         CDS       T04896                                  Symbol POLE4 Name (RefSeq) DNA polymerase epsilon subunit 4   KO K03506   DNA polymerase epsilon subunit 4 [EC:2.7.7.7] Organism acyg  Anser cygnoides (swan goose) Pathway acyg03030   DNA replication acyg03410   Base excision repair acyg03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:acyg00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     125184485 (POLE4)    03410 Base excision repair     125184485 (POLE4)    03420 Nucleotide excision repair     125184485 (POLE4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:acyg03032]     125184485 (POLE4)    03400 DNA repair and recombination proteins [BR:acyg03400]     125184485 (POLE4) Enzymes [BR:acyg01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      125184485 (POLE4) DNA replication proteins [BR:acyg03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     125184485 (POLE4) DNA repair and recombination proteins [BR:acyg03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       125184485 (POLE4) SSDB OrthologParalogGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C TAF TFIID-31kDa SlpA CENP-S Motif Other DBs NCBI-GeneID:  125184485 NCBI-ProteinID:  XP_066839763 LinkDB All DBs Position 27:complement(4454725..4457076) Genome browser AA seq 119 aa AA seqDB search MAAAAVPVAAAAAAAAAGSEPAGPGEEAGAGPQCPGPARLARLPLARVKALVKADPDVTL ASQEAVFVLARATELFVETIAKDAYVYAQQGKRKTLQRKDLDNAIEAIDEFAFLEGTLD NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggcggcggcggccgtgccggtggcggcggcggcggcggcggcagcggcgggctcggag ccggcggggccgggggaggaggcgggcgcggggccgcagtgcccggggccggcccgcctg gcccgcctgccgctggcgcgggtgaaggcgctggtgaaggcggacccggacgtcaccctg gccagccaggaggccgtcttcgtcctggcgcgggccacggagttgtttgttgaaaccata gccaaagatgcttatgtgtacgctcagcaaggaaaaagaaaaactctgcagagaaaagat ctggataatgctattgaagctattgatgaatttgcttttttggaaggtactttggactga

DBGET integrated database retrieval system