KEGG   Acropora digitifera (stony coral): 107345145
Entry
107345145         CDS       T04352                                 

Definition
(RefSeq) uncharacterized LOC107345145
  KO
K02373  FAS-associated death domain protein
Organism
adf  Acropora digitifera (stony coral)
Pathway
adf04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:adf00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    107345145
SSDB
Motif
Pfam: DED Nucleic_acid_bd PYRIN
Other DBs
NCBI-GeneID: 107345145
NCBI-ProteinID: XP_015766339
LinkDB
Position
Un
AA seq 203 aa
MLLRPFLVFLERLAKEIVSDNLESFKFMLRGRIPDGLLEECSTPRQLFTCMMRNNLLGEN
KLEVLEELLSESREDLLCRVKNFRPQFPSSVMVLVHFSFFGLSEDVIQYNSGILVANMSH
NFNISPQTMRYVRWQQDAPGWISVTFEVPHERVDQLRSHAIGVEKWLLDCGVKAVRIADE
AQILLQPITATSNLATAVSHAGE
NT seq 612 nt   +upstreamnt  +downstreamnt
atgctgttgcgtccattcttggtgttcttagaacgactagcaaaggaaatcgtctccgac
aatctagagtccttcaaatttatgctccgtggacgcatccctgatggacttctggaagaa
tgttcaactccgaggcaattgttcacgtgtatgatgagaaacaatttgttaggagaaaat
aaacttgaagttcttgaagagttgctgtcagagtcgcgagaagatcttttgtgtagagtc
aaaaattttagaccgcaatttccgtcctcagttatggtattggtgcatttctcatttttc
ggattaagtgaagatgtcatacaatataattcgggtattttagtggccaatatgtcacat
aatttcaatataagtcctcaaacaatgcgctatgtacgatggcaacaggatgcacctggt
tggatcagtgtgacatttgaagtaccacatgaaagagtggatcagctgcgtagccatgct
attggtgtagaaaaatggctgttagattgtggggttaaggcagtaagaattgccgatgag
gctcaaatacttttgcagcccataacagctacatccaatttagcaactgctgtctcacat
gcaggtgagtaa

KEGG   Acropora digitifera (stony coral): 107355604
Entry
107355604         CDS       T04352                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member 10B-like
  KO
K02373  FAS-associated death domain protein
Organism
adf  Acropora digitifera (stony coral)
Pathway
adf04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:adf00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    107355604
SSDB
Motif
Pfam: Death
Other DBs
NCBI-GeneID: 107355604
NCBI-ProteinID: XP_015777685
LinkDB
Position
Un
AA seq 132 aa
MSHSVIGTECNENIFWFSDPSGFVIPEHLRTRYDKPITEQDCVCICDDIVDWKMLLRHLK
VSEGIIRNVDEDYRRTNEKSYQGLLEWKRTRANEATIRNLCTALWSIRYTEALEKLSSQD
AGPRLLDIPETV
NT seq 399 nt   +upstreamnt  +downstreamnt
atgtcacacagtgttatcggtactgaatgcaacgagaatattttttggttttcagaccct
tcaggctttgtaataccagaacatttgcgcacacgttacgacaagcccattacagaacag
gactgtgtttgtatatgcgatgacattgtggattggaaaatgcttttacgacatttgaag
gtatcagaagggattatcagaaatgtagacgaagattacagaaggacaaacgaaaaaagt
tatcaagggcttttggaatggaaaaggacccgggccaatgaagctacaataagaaatttg
tgtactgccttgtggtctattcgttacacagaagcgcttgaaaaattgtctagccaagat
gctggcccgagactgcttgacatcccagaaactgtttga

DBGET integrated database retrieval system