Acropora digitifera (stony coral): 107353174 Help Entry 107353174         CDS       T04352                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism adf  Acropora digitifera (stony coral) Pathway adf00510   N-Glycan biosynthesis adf00513   Various types of N-glycan biosynthesis adf04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:adf00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     107353174    00513 Various types of N-glycan biosynthesis     107353174  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     107353174 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ost5 DUF6512 TctB DUF7318 Motif Other DBs NCBI-GeneID:  107353174 NCBI-ProteinID:  XP_015774980 LinkDB All DBs Position Un AA seq 82 aa AA seqDB search MEALSMEQMNRYASPINPAVFPHLTIVLLSIGIFFMAWFFVYEVTSTKYNRDIYKELLVS LVASLFMGFGVLFLLLWVGIYV NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggaagccttatcgatggagcagatgaacagatatgctagtccgatcaaccctgccgta tttcctcatctgaccattgtgctcctttccattgggatattcttcatggcttggttcttt gtctatgaagttacctccaccaagtacaatcgagacatctacaaagagcttctggtgtca ttagttgcatctcttttcatgggatttggtgttttatttttgcttttgtgggtgggaata tatgtttga

DBGET integrated database retrieval system