Alloacidobacterium dinghuense: H7849_25315
Help
Entry
H7849_25315 CDS
T08177
Name
(GenBank) glucose 1-dehydrogenase
KO
K00059
3-oxoacyl-[acyl-carrier protein] reductase [EC:
1.1.1.100
]
Organism
adin
Alloacidobacterium dinghuense
Pathway
adin00061
Fatty acid biosynthesis
adin00780
Biotin metabolism
adin01100
Metabolic pathways
adin01110
Biosynthesis of secondary metabolites
adin01212
Fatty acid metabolism
adin01240
Biosynthesis of cofactors
Module
adin_M00083
Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:
adin00001
]
09100 Metabolism
09103 Lipid metabolism
00061 Fatty acid biosynthesis
H7849_25315
09108 Metabolism of cofactors and vitamins
00780 Biotin metabolism
H7849_25315
09110 Biosynthesis of other secondary metabolites
00333 Prodigiosin biosynthesis
H7849_25315
09180 Brite Hierarchies
09181 Protein families: metabolism
01004 Lipid biosynthesis proteins [BR:
adin01004
]
H7849_25315
Enzymes [BR:
adin01000
]
1. Oxidoreductases
1.1 Acting on the CH-OH group of donors
1.1.1 With NAD+ or NADP+ as acceptor
1.1.1.100 3-oxoacyl-[acyl-carrier-protein] reductase
H7849_25315
Lipid biosynthesis proteins [BR:
adin01004
]
Fatty acid synthase
Component type
H7849_25315
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
adh_short_C2
adh_short
KR
SDR
DUF1776
Epimerase
THF_DHG_CYH_C
Motif
Other DBs
NCBI-ProteinID:
QNI32264
UniProt:
A0A7G8BI94
LinkDB
All DBs
Position
6013458..6014207
Genome browser
AA seq
249 aa
AA seq
DB search
MGKLQGKVAVVTGASKGIGAAIAKSLAAEGAAVVVNYSSSKEGADRVVSEISSKGGKAIA
VQGSVAKAADVNRIFAETKKAFGKLDVLVNNAGVYEFTPIEDITEEHYYRIFDTNVLGLL
LASREAVKHFNGDGGSIINIGSVASRVTPPTSSVYSGTKGAVDAITQTLAKELGPKKIRV
NSINPGMVETEGVHSAGFIGSEFHKQHEAQVPLGRIGQPEDIANIAVFLASADSGWLSGE
LVIASGGYR
NT seq
750 nt
NT seq
+upstream
nt +downstream
nt
atgggcaagcttcagggtaaagtcgccgttgttactggcgcatcgaaaggtattggcgcg
gccattgccaagagtctggctgcggaaggcgcagctgttgttgtgaattattcctccagc
aaagagggagcagatcgcgtcgtgagtgagatttcgagcaagggcggtaaagccattgcg
gtgcagggaagtgttgcgaaagcagccgacgtaaaccgtatctttgccgagacgaaaaag
gcttttggcaagctggacgttttggtgaacaatgctggcgtttacgaattcaccccaatt
gaggacatcacggaagagcactactatcgcattttcgacacaaacgtgcttggtctgctc
cttgcctccagagaggcggtaaagcactttaatggtgatggaggcagcatcatcaacatc
ggctcggttgccagcagggttacaccgcctacgtcgtcggtttacagcgggacgaagggc
gctgtcgatgcgatcacgcagactctggccaaggaacttggcccgaagaagattcgcgtg
aactcgatcaaccccggaatggtggagacggaaggcgttcactctgcaggattcatcggc
agtgaattccataagcagcatgaggcgcaagttcctcttggacgcatcggtcagcctgag
gacattgcgaacatcgccgttttcctggcatctgccgattcaggatggttgtcaggcgaa
ttggttatcgcctcgggtggctatcggtaa
DBGET
integrated database retrieval system