Arachis duranensis: 107477744 Help Entry 107477744         CDS       T04300                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism adu  Arachis duranensis Pathway adu03420   Nucleotide excision repair adu04120   Ubiquitin mediated proteolysis adu04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:adu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     107477744    04120 Ubiquitin mediated proteolysis     107477744   09124 Replication and repair    03420 Nucleotide excision repair     107477744  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:adu04121]     107477744    03400 DNA repair and recombination proteins [BR:adu03400]     107477744 Enzymes [BR:adu01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      107477744 Ubiquitin system [BR:adu04121]  Ubiquitin ligases (E3)   UBL E3 ligases    107477744   Multi subunit type E3    SCF complex     Ring finger protein      107477744    Cul2 complex      107477744    Cul3 complex      107477744    Cul4 complex      107477744    Cul7 complex      107477744    Cul8 complex      107477744    Cul9 complex      107477744 DNA repair and recombination proteins [BR:adu03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       107477744     TCR (transcription coupled repair) factors      Cul4-CSA complex       107477744 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 Motif Other DBs NCBI-GeneID:  107477744 NCBI-ProteinID:  XP_015953299 UniProt:  A0A6P4CMK0 LinkDB All DBs Position 3:13941100..13943297 Genome browser AA seq 117 aa AA seqDB search MATLDSDVPMVPAGEPSSSAAGPSTKKPKRFEIKKWNAVALWAWDIVVDNCAICRNHIMD LCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggcgacacttgattccgatgttcctatggtccccgccggcgagccctccagcagcgcc gccggcccttccaccaagaagcccaagcgcttcgagatcaagaagtggaacgccgttgct ctatgggcttgggatattgttgtggataactgtgccatctgcaggaaccacatcatggat ctctgtatcgagtgccaagctaatcaagctagtgccactagcgaggaatgcactgtggct tggggggtttgtaaccatgcttttcacttccattgcattagtcgatggctcaagactcgt caagtatgtcctctagataacagtgagtgggaatttcagaaatatggtcactag

DBGET integrated database retrieval system