Arachis duranensis: 127744049 Help Entry 127744049         CDS       T04300                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism adu  Arachis duranensis Pathway adu03420   Nucleotide excision repair adu04120   Ubiquitin mediated proteolysis adu04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:adu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     127744049    04120 Ubiquitin mediated proteolysis     127744049   09124 Replication and repair    03420 Nucleotide excision repair     127744049  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:adu04121]     127744049    03400 DNA repair and recombination proteins [BR:adu03400]     127744049 Enzymes [BR:adu01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      127744049 Ubiquitin system [BR:adu04121]  Ubiquitin ligases (E3)   UBL E3 ligases    127744049   Multi subunit type E3    SCF complex     Ring finger protein      127744049    Cul2 complex      127744049    Cul3 complex      127744049    Cul4 complex      127744049    Cul7 complex      127744049    Cul8 complex      127744049    Cul9 complex      127744049 DNA repair and recombination proteins [BR:adu03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       127744049     TCR (transcription coupled repair) factors      Cul4-CSA complex       127744049 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  127744049 NCBI-ProteinID:  XP_052112279 UniProt:  A0A6P4B9T3 LinkDB All DBs Position Unknown AA seq 116 aa AA seqDB search MATLDSDVPMVPAGEPSSSAGPSSKKPKRFEIKKWNAVALWAWDIVVDNCAICRNHIMDL CIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggcaactctggactccgacgtaccaatggttccggccggcgagccttccagcagcgcg ggtccttcctccaagaagcccaagcgcttcgagatcaagaaatggaacgctgttgctctc tgggcttgggatatagttgttgataactgcgctatttgccggaaccatatcatggatctc tgcattgagtgccaggctaatcaggctagcgccactagcgaggaatgcactgtagcgtgg ggagtttgcaaccatgcttttcacttccattgcataagcagatggctcaagacccgtcaa gtttgccctctagataatagcgagtgggagtttcagaaatatggccactag

DBGET integrated database retrieval system