Aeromonas salmonicida O23A: O23A_p3193 Help Entry O23A_p3193        CDS       T04990                                  Name (GenBank) Dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism aeo  Aeromonas salmonicida O23A Pathway aeo00790   Folate biosynthesis aeo01100   Metabolic pathways aeo01240   Biosynthesis of cofactors Module aeo_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:aeo00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     O23A_p3193 Enzymes [BR:aeo01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      O23A_p3193  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      O23A_p3193  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      O23A_p3193 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  ARW83932 UniProt:  A0AAP3UWY3 LinkDB All DBs Position 3387425..3387796 Genome browser AA seq 123 aa AA seqDB search MDKVFIRGLEVLTTIGVYEWEKGIRQKLCFDLEMGFDNRPAAATDDINLALDYATLSRKI CDHASSKVVELVETMAEQVAMLVLADERVQWVKVTLTKPGAVPNAAGVGVEILRHRTPAA SAC NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atggacaaggtgtttattcgcggactcgaggttttgaccaccatcggtgtatatgagtgg gagaagggcattcgccagaagctctgtttcgacctcgaaatggggtttgacaaccgtccc gccgctgcaaccgacgatatcaatctggcactggattacgccaccctctctcgcaagatc tgtgatcacgcctccagcaaggttgtggagctggtcgaaaccatggccgagcaggtcgcc atgctggtactggccgacgagcgggtgcaatgggtcaaggtcaccctgaccaaaccgggt gctgtccccaatgcggctggcgtcggggtagagatactgcgccatcgcactccggctgcg agcgcctgctga

DBGET integrated database retrieval system