Actinidia eriantha (wild kiwifruit): 130756745 Help Entry 130756745         CDS       T09464                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism aew  Actinidia eriantha (wild kiwifruit) Pathway aew03420   Nucleotide excision repair aew04120   Ubiquitin mediated proteolysis aew04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:aew00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     130756745    04120 Ubiquitin mediated proteolysis     130756745   09124 Replication and repair    03420 Nucleotide excision repair     130756745  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:aew04121]     130756745    03400 DNA repair and recombination proteins [BR:aew03400]     130756745 Enzymes [BR:aew01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      130756745 Ubiquitin system [BR:aew04121]  Ubiquitin ligases (E3)   UBL E3 ligases    130756745   Multi subunit type E3    SCF complex     Ring finger protein      130756745    Cul2 complex      130756745    Cul3 complex      130756745    Cul4 complex      130756745    Cul7 complex      130756745    Cul8 complex      130756745    Cul9 complex      130756745 DNA repair and recombination proteins [BR:aew03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       130756745     TCR (transcription coupled repair) factors      Cul4-CSA complex       130756745 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  130756745 NCBI-ProteinID:  XP_057467298 LinkDB All DBs Position 20:20156157..20160314 Genome browser AA seq 125 aa AA seqDB search MASLDTDVTMVPAGEGSSGAVPSSSTASTSSSSKKAKRFEIKKWNAVALWAWDIVVDNCA ICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEF QKYGH NT seq 378 nt NT seq  +upstreamnt  +downstreamnt atggcttctctagacaccgacgtcacgatggttccggccggcgagggttcaagcggcgcc gtaccgtcttcctccaccgcctcaacgtcgtcctcatcgaagaaggccaagcgattcgag atcaaaaaatggaacgccgtcgctctctgggcctgggatattgttgttgataactgtgcg atttgcaggaatcatatcatggatctatgcattgagtgccaagctaaccaagctagtgcc acaagcgaggaatgcactgttgcttggggggtttgcaaccatgcattccacttccactgc atcagccgatggctcaagacacgtcaagtgtgtccactggataacagcgagtgggagttt cagaagtatggccactag

DBGET integrated database retrieval system