Actinidia eriantha (wild kiwifruit): 130761930 Help Entry 130761930         CDS       T09464                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism aew  Actinidia eriantha (wild kiwifruit) Pathway aew03420   Nucleotide excision repair aew04120   Ubiquitin mediated proteolysis aew04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:aew00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     130761930    04120 Ubiquitin mediated proteolysis     130761930   09124 Replication and repair    03420 Nucleotide excision repair     130761930  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:aew04121]     130761930    03400 DNA repair and recombination proteins [BR:aew03400]     130761930 Enzymes [BR:aew01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      130761930 Ubiquitin system [BR:aew04121]  Ubiquitin ligases (E3)   UBL E3 ligases    130761930   Multi subunit type E3    SCF complex     Ring finger protein      130761930    Cul2 complex      130761930    Cul3 complex      130761930    Cul4 complex      130761930    Cul7 complex      130761930    Cul8 complex      130761930    Cul9 complex      130761930 DNA repair and recombination proteins [BR:aew03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       130761930     TCR (transcription coupled repair) factors      Cul4-CSA complex       130761930 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  130761930 NCBI-ProteinID:  XP_057473510 LinkDB All DBs Position 23:22298996..22302237 Genome browser AA seq 115 aa AA seqDB search MATDAIMVPVDEASNVAGPSSSSKKAKRFEIKKWNAVALWAWDIVVDNCAICRNHIMDLC IECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atggccaccgacgcgatcatggttccggttgacgaggcatcgaacgtcgccggaccttcg tcctcttcgaagaaggctaagcgcttcgaaatcaagaagtggaacgccgtcgctctctgg gcttgggatatcgttgtggacaactgtgcgatttgcaggaaccacatcatggatctctgc attgaatgccaagctaatcaagccagtgcgactagtgaggagtgcaccgtcgcttggggt gtttgcaatcatgccttccatttccactgcatcagccgatggctcaaaacccgccaagtg tgcccgcttgataacagtgaatgggaattccagaagtacggtcactag

DBGET integrated database retrieval system