Anoplopoma fimbria (sablefish): 129108201 Help Entry 129108201         CDS       T09102                                  Symbol tmem258 Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism afb  Anoplopoma fimbria (sablefish) Pathway afb00510   N-Glycan biosynthesis afb00513   Various types of N-glycan biosynthesis afb04141   Protein processing in endoplasmic reticulum Module afb_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:afb00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     129108201 (tmem258)    00513 Various types of N-glycan biosynthesis     129108201 (tmem258)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     129108201 (tmem258) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 DUF6512 TctB Motif Other DBs NCBI-GeneID:  129108201 NCBI-ProteinID:  XP_054475879 LinkDB All DBs Position 19:500107..502836 Genome browser AA seq 79 aa AA seqDB search MELEAMTRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDVYKELLISLVA SLFMGFGVLFLLLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggaactcgaggctatgaccagatacaccagcccggtgaacccggccgtgttcccccac ctcaccgtggtgctgctggccatcggcatgttcttcaccgcctggttcttcgtctacgag gtgacatcaacaaaatacaccagggacgtctacaaagagctgctgatctccctggtggct tcccttttcatgggctttggcgtgctgttcttactactctgggttggcatctatgtataa

DBGET integrated database retrieval system