Acidithiobacillus ferrooxidans ATCC 53993: Lferr_0903
Help
Entry
Lferr_0903 CDS
T00758
Name
(GenBank) DNA ligase, NAD-dependent
KO
K01972
DNA ligase (NAD+) [EC:
6.5.1.2
]
Organism
afe
Acidithiobacillus ferrooxidans ATCC 53993
Pathway
afe03030
DNA replication
afe03410
Base excision repair
afe03420
Nucleotide excision repair
afe03430
Mismatch repair
Brite
KEGG Orthology (KO) [BR:
afe00001
]
09120 Genetic Information Processing
09124 Replication and repair
03030 DNA replication
Lferr_0903
03410 Base excision repair
Lferr_0903
03420 Nucleotide excision repair
Lferr_0903
03430 Mismatch repair
Lferr_0903
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03032 DNA replication proteins [BR:
afe03032
]
Lferr_0903
03400 DNA repair and recombination proteins [BR:
afe03400
]
Lferr_0903
Enzymes [BR:
afe01000
]
6. Ligases
6.5 Forming phosphoric-ester bonds
6.5.1 Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
6.5.1.2 DNA ligase (NAD+)
Lferr_0903
DNA replication proteins [BR:
afe03032
]
Prokaryotic type
DNA Replication Elongation Factors
Elongation factors (bacterial)
Other elongation factors
Lferr_0903
DNA repair and recombination proteins [BR:
afe03400
]
Prokaryotic type
SSBR (single strand breaks repair)
BER (base exicision repair)
DNA ligase
Lferr_0903
NER (nucleotide excision repair)
GGR (global genome repair) factors
Lferr_0903
MMR (mismatch excision repair)
DNA ligase
Lferr_0903
DSBR (double strand breaks repair)
NHEJ (non-homologous end-joining)
SHDIR (short-homology-dependent illegitimate recombination)
RecET pathway
Lferr_0903
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
DNA_ligase_aden
DNA_ligase_OB
HHH_2
BRCT
HHH_5
DNA_ligase_ZBD
Nlig-Ia
PTCB-BRCT
HHH
BRCT_2
Prot_ATP_ID_OB_C
DUF4796_N
Motif
Other DBs
NCBI-ProteinID:
ACH83152
UniProt:
B5EP61
LinkDB
All DBs
Position
864796..866811
Genome browser
AA seq
671 aa
AA seq
DB search
MERVNHTDFERIQQLRAELVAANNAYYREDSPTLSDAEYDARLRELRTLEDRNPQWQSAD
SPTQRVGAAPVEVFGEVHYAIPLTSLDNVFDQDGFSDWLARVQKGLGREDVPLSAEPKFD
GLSVNIRYIEGKLVQAGTRGDGQTGEDVTANVRTIRNVPLQLTGKDWPELLEVRGEVVIP
VAAFRRLNGERLRAGDNPFANPRNAAAGSLRQLDSSVTAKRPLAYFPWGWGESSVPLGKS
HIAVMERLSAWGFEVTSYLRGVHELTECQRYFSEMQKIREGMPFEIDGLVFKVDDLLARE
QLGFTARAPRWAIAYKFPAHEERTVVEDILASVGRTGVITPVAVLKPVQVGGVTVSRASL
HNQDEVDRKDIRVGDTVLVRRAGDVIPEVVMVIKEERPPATQPWHMPQRCPVCGSEVLRL
ANESAHRCMGGLYCPAQRMGAIRHFASRRAMDIRGLGEKLVEQLVGHGLVHTVADIYHLD
EAALCGLERMASRSAQKLLAEIDRSRHTSLPRFLYALGIRQVGEGTAKSLAIYFGDLDPL
MAATPELLQNIPDVGPIVAESVAHFFAQPHNRDVIAALRAAGVQWAVVQPQKGGRFQGMT
LVLTGALDNMTREEAKTAIENAGGKVSGSVSAKTSYVVVGKDPGSKAEKAAKLGVKQLTE
AQFLAMFSEKE
NT seq
2016 nt
NT seq
+upstream
nt +downstream
nt
gtggagcgggtcaaccatactgacttcgagcgtattcagcaattgcgtgcggaactggtg
gcggccaataacgcctactatcgggaagattcgccgaccctgagtgatgccgagtacgat
gcgcgcctgcgcgaactgcgcaccctggaggaccgtaatccccaatggcaaagcgccgac
tctccgacccagagggtcggggcggctccggtggaggtctttggggaagtgcattatgcc
atacccctgacctctctcgacaatgtgttcgatcaagacggttttagcgactggctggcg
cgcgtgcagaaggggctcggccgcgaggatgttccgctcagtgctgaacccaagtttgac
ggtctctcggtcaacattcgctacatcgagggtaagctggtacaggctggtacccgtgga
gatggccagaccggtgaagatgtcaccgccaacgtccgcaccattcgcaacgtccccctg
caactgacaggcaaggactggccggagctgctggaagtccgtggagaggtggtcatcccc
gtggccgctttccggcgtctgaatggcgagcgtctgcgcgccggggataacccctttgcc
aacccccgcaatgcggcggcaggcagtctgcgacaactggattccagcgtaacggcaaag
cgccccctcgcgtacttcccctggggatggggagaaagcagcgtgccactggggaaaagc
cacatcgcggttatggaacgcctttctgcctggggcttcgaggtgacctcctatctgcgc
ggtgttcacgaactcacggaatgccaacgctatttcagcgagatgcagaaaatacgcgaa
ggcatgccttttgaaatagacggcctcgtgttcaaagttgacgatctgctcgccagggaa
cagttgggcttcaccgcccgcgcaccgcgttgggccattgcctataaatttccggcgcac
gaagagcgtaccgtggtcgaagatatcctggcttccgtagggcgcaccggtgtgattact
cctgtggctgtcttgaagcccgtgcaggtgggcggcgtaaccgtgagccgcgccagcttg
cataatcaggatgaagtggatcgtaaggatattcgcgtgggcgacacggtgctggtacgc
cgcgccggcgacgtgatcccggaagtggtcatggtgatcaaagaggagcggccgcctgcg
acacaaccctggcacatgccgcagcgttgtccggtctgcggctcggaggtcttgcgcctg
gccaacgagtcggcgcatcgttgcatgggcgggctgtactgcccggcacagcggatgggc
gccattcggcactttgcgtcgcgtcgggccatggacatccgggggctgggcgaaaagctc
gttgagcaactggtcgggcatggtctggtgcacaccgtggccgatatctaccatctggat
gaagcggctctgtgcggcttggagcgcatggccagccgttcggcgcaaaagctcctcgcc
gaaatcgatcgctcccgccatacctccttgccccgttttctctacgccctgggtatccgt
caggttggggagggtacggccaaatccctggccatctatttcggggatctggaccccctg
atggccgcaacaccggagcttttgcagaacattcccgatgtagggcctatcgtggcggaa
tccgttgcccatttttttgcccagccccataaccgcgacgtcattgccgccctgcgcgcg
gcaggagtacagtgggctgtggtccagccgcaaaaaggcgggcgttttcagggtatgacc
ctggtgctcaccggagccttggacaacatgacccgggaagaggccaaaaccgccatagaa
aacgcgggcgggaaagtcagcggttccgtgtcggccaaaacaagctatgtggtagtcggc
aaggatcccggcagtaaggccgaaaaggccgcaaagctgggtgtgaaacagcttaccgag
gcgcaatttttggcgatgttttcagaaaaggaatga
DBGET
integrated database retrieval system