Aptenodytes forsteri (emperor penguin): 103897829 Help Entry 103897829         CDS       T08527                                  Symbol CXCL12 Name (RefSeq) stromal cell-derived factor 1   KO K10031   C-X-C motif chemokine 12 Organism afor  Aptenodytes forsteri (emperor penguin) Pathway afor04060   Cytokine-cytokine receptor interaction afor04672   Intestinal immune network for IgA production afor04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:afor00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103897829 (CXCL12)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     103897829 (CXCL12)  09150 Organismal Systems   09151 Immune system    04672 Intestinal immune network for IgA production     103897829 (CXCL12)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:afor04052]     103897829 (CXCL12)    00536 Glycosaminoglycan binding proteins [BR:afor00536]     103897829 (CXCL12) Cytokines and neuropeptides [BR:afor04052]  Cytokines   Chemokines    103897829 (CXCL12) Glycosaminoglycan binding proteins [BR:afor00536]  Heparan sulfate / Heparin   Chemokines    103897829 (CXCL12) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  103897829 NCBI-ProteinID:  XP_009276279 LinkDB All DBs Position Unknown AA seq 137 aa AA seqDB search MKACRATLSWRAARGSNVSFLSLCPTEKPVSLTYRCPCRFYESNVARANIKHLKILSTPN CSLQIVARLKSNSKQVCIDPKLKWIQEYLEKALNKPRHRTHKKKQQKKRGPLCPSRATPL KSPGRKNGGSRCKRQAL NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgaaggcttgcagggctaccttgtcctggagggcagcaagagggagtaacgtgtccttt ctctccctgtgtcccacagagaaacccgtcagcctgacttaccgatgcccctgtcgattc tacgagagcaacgtggcaagagccaacattaagcacctcaaaatcctctccacacccaac tgctcacttcagattgttgcaaggctcaagagcaacagcaagcaagtgtgcattgatccc aagttaaagtggatccaggaatatctggagaaagctttaaacaaaccacgtcatcgcact cataaaaaaaagcaacagaagaaacggggcccactctgcccttcccgtgcaacaccacta aagtctccagggagaaagaatggaggttcaagatgtaagaggcaagcattgtaa

DBGET integrated database retrieval system