Aptenodytes forsteri (emperor penguin): 103900349 Help Entry 103900349         CDS       T08527                                  Symbol DHFR Name (RefSeq) dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism afor  Aptenodytes forsteri (emperor penguin) Pathway afor00670   One carbon pool by folate afor00790   Folate biosynthesis afor01100   Metabolic pathways afor01240   Biosynthesis of cofactors afor04981   Folate transport and metabolism Brite KEGG Orthology (KO) [BR:afor00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     103900349 (DHFR)    00670 One carbon pool by folate     103900349 (DHFR)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     103900349 (DHFR) Enzymes [BR:afor01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      103900349 (DHFR) SSDB OrthologParalogGFIT Motif Pfam:  DHFR_1 US2 Motif Other DBs NCBI-GeneID:  103900349 NCBI-ProteinID:  XP_009279286 LinkDB All DBs Position Unknown AA seq 153 aa AA seqDB search MTSTSHVEGKQNALIMGKKTWFSIPEKNRPLKDRINIVLSRELKDTPKGAHYLSKSLDDA LALLDSPELKSKVDMVWIVGGTSVYKAAMEKPINHRLFVTRILQEFESDTFFPEIDYKDY KLLTEYPGVPAGIQEENGIQYKFEVYEKAVLAQ NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgactagcacatcccatgtggaaggtaaacagaatgccctgataatgggtaaaaaaacc tggttctccattcctgagaagaatcgtcctttaaaagacagaattaatatagtgctcagc agggagctcaaggataccccaaaaggagcacattatctttccaaaagtctggatgatgct ttagctcttttggattcaccagagttaaaaagtaaagtagacatggtttggatcgttgga gggacttcagtttacaaggcagcaatggagaagccaattaatcatcgattgtttgtgaca aggattttgcaggaatttgaaagtgacacctttttcccagaaatcgactacaaagattac aaacttctcactgagtacccaggtgtccctgctggtatccaagaagagaatggcatccag tacaaatttgaagtgtatgaaaaagctgtcttggcacaataa

DBGET integrated database retrieval system