Aptenodytes forsteri (emperor penguin): 103901564 Help Entry 103901564         CDS       T08527                                  Name (RefSeq) hepatic lectin-like   KO K06563   C-type lectin domain family 4 member L/M Organism afor  Aptenodytes forsteri (emperor penguin) Pathway afor03260   Virion - Human immunodeficiency virus afor03264   Virion - Flavivirus and Alphavirus afor03265   Virion - Ebolavirus, Lyssavirus and Morbillivirus afor03273   Virion - Lassa virus and SFTS virus afor04145   Phagosome afor04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:afor00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03260 Virion - Human immunodeficiency virus     103901564    03264 Virion - Flavivirus and Alphavirus     103901564    03265 Virion - Ebolavirus, Lyssavirus and Morbillivirus     103901564    03273 Virion - Lassa virus and SFTS virus     103901564  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     103901564  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     103901564  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:afor04131]     103901564   09183 Protein families: signaling and cellular processes    04054 Pattern recognition receptors [BR:afor04054]     103901564    04515 Cell adhesion molecules [BR:afor04515]     103901564    04090 CD molecules [BR:afor04090]     103901564    04091 Lectins [BR:afor04091]     103901564 Membrane trafficking [BR:afor04131]  Endocytosis   Phagocytosis    C-lectin receptors     103901564 Pattern recognition receptors [BR:afor04054]  Membrane-bound pattern recognition receptors   C-type lectin receptors    103901564 Cell adhesion molecules [BR:afor04515]  Lectins   Selectins and C-type lectins    103901564 CD molecules [BR:afor04090]  Proteins   103901564 Lectins [BR:afor04091]  C-Type lectins   Asialoglycoprotein and DC receptors    103901564 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Lectin_C Motif Other DBs NCBI-GeneID:  103901564 NCBI-ProteinID:  XP_009280744 LinkDB All DBs Position Unknown AA seq 208 aa AA seqDB search MDEEHLHDDLHVFKDRNFFRQKLRSFFTVYLLLALSFLLIITLFAVSLSRVSAISSKLNE VQPERKQNFSGRDFLLFPCGPGSREWEYFDGKCYYFSLTRMSWYKAKAQCEEMHSRLAII NSYAKQNFVMFRTRNERFWIGLTDENSEGEWEWIDGTDYKTTFTFWKEGEPNNSGSNEDC AHIWVSGKWNDVYCTYECYYVCEKPLPN NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atggacgaggaacatcttcacgacgacctgcacgtttttaaagacagaaacttcttccgg cagaagctgagatcctttttcacggtatacttgctactggccctctccttcttgctgatc atcaccctgttcgctgtgtcgctctccagagtttcagccatttcttctaaactcaacgag gtgcagccggaacggaaacagaacttttccggcagggattttctgttgtttccctgcgga cccggatccagggaatgggaatacttcgatggaaaatgttactacttctccctgaccaga atgagctggtacaaggcgaaggctcagtgcgaagagatgcactcgcggttggctatcatt aacagctacgccaagcagaattttgtcatgttcaggacaaggaatgagcgtttctggatc gggctcacggacgagaattcggaaggggaatgggaatggatcgacgggaccgactataaa accacgttcacattttggaaggagggagagcccaacaacagcggcagcaacgaagattgt gcccacatctgggtctccgggaagtggaacgacgtctactgcacctatgagtgctactac gtctgcgaaaagcctctgcccaactga

DBGET integrated database retrieval system