Artemia franciscana: 136038991 Help Entry 136038991         CDS       T10524                                  Name (RefSeq) RING-box protein 1A-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism afra  Artemia franciscana Pathway afra03420   Nucleotide excision repair afra04120   Ubiquitin mediated proteolysis afra04141   Protein processing in endoplasmic reticulum afra04310   Wnt signaling pathway afra04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:afra00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     136038991    04120 Ubiquitin mediated proteolysis     136038991   09124 Replication and repair    03420 Nucleotide excision repair     136038991  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     136038991    04350 TGF-beta signaling pathway     136038991  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:afra04121]     136038991    03400 DNA repair and recombination proteins [BR:afra03400]     136038991 Enzymes [BR:afra01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      136038991 Ubiquitin system [BR:afra04121]  Ubiquitin ligases (E3)   UBL E3 ligases    136038991   Multi subunit type E3    SCF complex     Ring finger protein      136038991    Cul2 complex      136038991    Cul3 complex      136038991    Cul4 complex      136038991    Cul7 complex      136038991    Cul8 complex      136038991    Cul9 complex      136038991 DNA repair and recombination proteins [BR:afra03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       136038991     TCR (transcription coupled repair) factors      Cul4-CSA complex       136038991 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 ZZ zf-RING_16 PHD_NSD Motif Other DBs NCBI-GeneID:  136038991 NCBI-ProteinID:  XP_065578582 LinkDB All DBs Position 18:4592559..4592897 Genome browser AA seq 112 aa AA seqDB search MCDKGVNIDKSSNNHHTDSVREKKKRFKVVKFGPVSTWAWDVAVETCAICRNNFYDLCIE CEAKHTADTEDCSGAWGVCNHAFHLHCIAKWLKTREVCPLDNTPWQYQNLTI NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atgtgtgacaaaggagttaatatagataaaagttcaaataatcaccatacagattcagta cgtgaaaagaaaaaacggttcaaagtagtgaagtttggtcctgtttccacttgggcttgg gatgttgctgtggagacctgtgctatttgtcggaataacttctacgatttatgtatagag tgcgaggctaagcatacagctgatacagaagattgcagtggagcatggggtgtatgtaac cacgcttttcatttgcattgcatagctaaatggttgaaaacacgggaagtctgtccccta gacaatacaccttggcaataccaaaatttgacaatctaa

DBGET integrated database retrieval system