Aythya fuligula (tufted duck): 116491233 Help Entry 116491233         CDS       T07966                                  Symbol CXCL12 Name (RefSeq) stromal cell-derived factor 1   KO K10031   C-X-C motif chemokine 12 Organism aful  Aythya fuligula (tufted duck) Pathway aful04060   Cytokine-cytokine receptor interaction aful04672   Intestinal immune network for IgA production aful04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:aful00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     116491233 (CXCL12)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     116491233 (CXCL12)  09150 Organismal Systems   09151 Immune system    04672 Intestinal immune network for IgA production     116491233 (CXCL12)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:aful04052]     116491233 (CXCL12)    00536 Glycosaminoglycan binding proteins [BR:aful00536]     116491233 (CXCL12) Cytokines and neuropeptides [BR:aful04052]  Cytokines   Chemokines    116491233 (CXCL12) Glycosaminoglycan binding proteins [BR:aful00536]  Heparan sulfate / Heparin   Chemokines    116491233 (CXCL12) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  116491233 NCBI-ProteinID:  XP_032046953 UniProt:  A0A6J3DBT2 LinkDB All DBs Position 7:complement(19702090..19719613) Genome browser AA seq 131 aa AA seqDB search MELRALALLAFALALVSLSEEKPVSLTYRCPCRFYESNVARANIKHLKILSTPNCSLQIV ARLKSNSKQVCIDPKLKWIQEYLEKALNKPRHRTHKKKQQKKRGPLCPSRATPLKSPGRK NGGSRCKRQAL NT seq 396 nt NT seq  +upstreamnt  +downstreamnt atggagctccgcgccctcgccctgctcgccttcgccctggccctcgtctccctctcggag gagaaacccgtcagcctgacttaccgatgtccctgtcgattctacgagagcaacgtggcc agagccaacattaagcacctcaaaatcctctccacccccaactgctcacttcagattgtt gcaaggctcaagagcaacagcaagcaagtgtgcattgatcccaagctaaagtggatccag gaatatctggagaaagctttaaacaaaccacgtcatcgcactcataaaaaaaagcaacag aagaaacggggcccactctgcccttcccgtgcaacaccactaaagtctccagggagaaag aatggaggttcaagatgtaagaggcaagcattgtaa

DBGET integrated database retrieval system