Aythya fuligula (tufted duck): 116500056 Help Entry 116500056         CDS       T07966                                  Name (RefSeq) hepatic lectin-like   KO K06563   C-type lectin domain family 4 member L/M Organism aful  Aythya fuligula (tufted duck) Pathway aful03260   Virion - Human immunodeficiency virus aful03264   Virion - Flavivirus and Alphavirus aful03265   Virion - Ebolavirus, Lyssavirus and Morbillivirus aful03273   Virion - Lassa virus and SFTS virus aful04145   Phagosome aful04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:aful00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03260 Virion - Human immunodeficiency virus     116500056    03264 Virion - Flavivirus and Alphavirus     116500056    03265 Virion - Ebolavirus, Lyssavirus and Morbillivirus     116500056    03273 Virion - Lassa virus and SFTS virus     116500056  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     116500056  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     116500056  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aful04131]     116500056   09183 Protein families: signaling and cellular processes    04054 Pattern recognition receptors [BR:aful04054]     116500056    04090 CD molecules [BR:aful04090]     116500056    04091 Lectins [BR:aful04091]     116500056 Membrane trafficking [BR:aful04131]  Endocytosis   Phagocytosis    C-lectin receptors     116500056 Pattern recognition receptors [BR:aful04054]  Membrane-bound pattern recognition receptors   C-type lectin receptors    116500056 CD molecules [BR:aful04090]  Proteins   116500056 Lectins [BR:aful04091]  C-Type lectins   Asialoglycoprotein and DC receptors    116500056 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Lectin_C Motif Other DBs NCBI-GeneID:  116500056 NCBI-ProteinID:  XP_032060842 UniProt:  A0A6J3EFZ2 LinkDB All DBs Position 30:complement(832184..834742) Genome browser AA seq 207 aa AA seqDB search MDEEHLHDDLHIFKGGTSFQKLRSFLTIYLLLALSFLLMITLFAVSLSRVSAISSKLNEV HTEKKQNFSNRDSLLFPCGPEAREWEYFDGKCYYFSIDRMSWYKAKTQCEEMHSRLAIIN SFAKQNFVMFRTRNERFWIGLTDGNSEGEWEWIDGTDYKSTFTFWKEGEPNNSGNNEDCA HVWTSGQWNDVYCTFECYYLCEKPVPN NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggatgaggaacatctccacgatgacctgcacatctttaaaggaggcaccagttttcag aagctgaggtcctttctcaccatttaccttctgctggcgctctccttcttgctgatgatc accttgttcgcggtgtcgctatccagagtttctgccatctcttctaaactcaacgaggtg cacacggagaagaaacagaacttttccaacagggattccctcttgtttccctgcggaccc gaagccagggagtgggaatatttcgatggcaaatgctactacttctccatcgacagaatg agctggtacaaggcaaagacccagtgcgaggagatgcactcgcgcctggccatcattaac agcttcgccaagcagaattttgtcatgttcaggacaaggaatgagcgcttctggattggg ctgacggacgggaactcggaaggggagtgggaatggatcgacggcaccgactacaagagc acgttcacattctggaaggaaggcgagcccaacaacagcggcaacaacgaggactgcgcc cacgtctggacctccgggcagtggaacgacgtctactgcaccttcgagtgctactacctc tgcgaaaagcctgtgcccaactga

DBGET integrated database retrieval system