KEGG   Aspergillus flavus: AFLA_009030
Entry
AFLA_009030       CDS       T01090                                 

Definition
(GenBank) hypothetical protein
  KO
K04126  isopenicillin-N synthase [EC:1.21.3.1]
Organism
afv  Aspergillus flavus
Pathway
afv00311  Penicillin and cephalosporin biosynthesis
afv01100  Metabolic pathways
afv01110  Biosynthesis of secondary metabolites
Module
afv_M00672  Penicillin biosynthesis, aminoadipate + cycteine + valine => penicillin
Brite
KEGG Orthology (KO) [BR:afv00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    AFLA_009030
Enzymes [BR:afv01000]
 1. Oxidoreductases
  1.21  Catalysing the reaction X-H + Y-H = X-Y
   1.21.3  With oxygen as acceptor
    1.21.3.1  isopenicillin-N synthase
     AFLA_009030
SSDB
Motif
Pfam: DIOX_N 2OG-FeII_Oxy
Other DBs
NCBI-ProteinID: KAF7622493
LinkDB
AA seq 331 aa
MASTLKANVPKIDVSPLFGDNMEEKMKAARAIDAASRDTGFFYAINHGIDVNRLSQKTKE
FHMSITDEEKWDLAIRAYNKEHQDQIRAGYYLSIPGKKAVESFCYLNPNFKSDHPRIQSK
TPTHEVNVWPDETKHPGFREFAEQYYWDVFGLSTALLRGYALALGKEEDFFSRHFKKDDA
LSSVVLIRYPFLDPYPPAAIKTAADGTKLSFEWHEDVSLITVLYQSNVQNLQVETPQGYL
DIEANDTGYLINCGSYMAHITNNYYPAPIHRVKWVNEERQSLPFFVNLGFDETIQPWDPR
SPDGKTDKEPVSYGQYLQNGLVSLINKNGQT
NT seq 996 nt   +upstreamnt  +downstreamnt
atggcttccactctcaaggccaatgtccccaagatcgatgtgtcgcccttgtttggtgac
aatatggaggagaagatgaaggccgcgcgcgcaattgacgctgcttcacgcgacaccggc
ttcttctatgcgatcaaccatggaatcgatgtgaatcgactctcgcagaagaccaaggag
ttccacatgtccattacagatgaagagaaatgggatcttgccattcgcgcctacaacaag
gagcaccaggaccagatccgagccgggtactacttatctatcccaggcaaaaaggctgtg
gaatccttctgctatctaaaccctaactttaagagcgaccaccctcgcattcaatcgaag
acacctactcacgaggtcaacgtgtggcccgacgagacgaagcatccgggcttccgcgaa
ttcgccgagcagtactactgggatgtgttcgggctctcgacggctctgctgcgaggctat
gctctggcactgggcaaagaggaggacttcttcagccgccactttaagaaggatgacgcc
ctctcctcggtcgttctcatccgctacccatttttagacccctacccaccagccgccatc
aagaccgcagcggacggcaccaaattaagttttgaatggcatgaagatgtgtcgctcatc
accgtcctgtaccagtccaacgtgcagaacctgcaagtggagacccctcaaggctacctt
gacatcgaggcgaacgacaccggctacctgatcaactgcggcagctacatggcacacatc
accaacaactactaccccgcccctattcatcgggtcaaatgggtgaacgaggagcgccaa
tcccttccattttttgtcaatctgggctttgacgagacaatccagccgtgggacccacgt
agccccgacggcaagaccgacaaggagccagtctcctacggccagtatctgcagaatggc
ctagttagcttgatcaacaagaatggtcagacctaa

DBGET integrated database retrieval system