KEGG   Alicyclobacillus mengziensis: JZ786_04930
Entry
JZ786_04930       CDS       T07322                                 
Symbol
ligA
Name
(GenBank) NAD-dependent DNA ligase LigA
  KO
K01972  DNA ligase (NAD+) [EC:6.5.1.2]
Organism
afx  Alicyclobacillus mengziensis
Pathway
afx03030  DNA replication
afx03410  Base excision repair
afx03420  Nucleotide excision repair
afx03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:afx00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    JZ786_04930 (ligA)
   03410 Base excision repair
    JZ786_04930 (ligA)
   03420 Nucleotide excision repair
    JZ786_04930 (ligA)
   03430 Mismatch repair
    JZ786_04930 (ligA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:afx03032]
    JZ786_04930 (ligA)
   03400 DNA repair and recombination proteins [BR:afx03400]
    JZ786_04930 (ligA)
Enzymes [BR:afx01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.2  DNA ligase (NAD+)
     JZ786_04930 (ligA)
DNA replication proteins [BR:afx03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     JZ786_04930 (ligA)
DNA repair and recombination proteins [BR:afx03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA ligase
     JZ786_04930 (ligA)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     JZ786_04930 (ligA)
   MMR (mismatch excision repair)
    DNA ligase
     JZ786_04930 (ligA)
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      JZ786_04930 (ligA)
SSDB
Motif
Pfam: DNA_ligase_aden DNA_ligase_OB HHH_2 HHH_5 BRCT DNA_ligase_ZBD Nlig-Ia HHH HHH_8 5_3_exonuc HHH_3 PTCB-BRCT Cdd1 BRCT_2 UPF0758_N
Other DBs
NCBI-ProteinID: QSO48335
UniProt: A0A9X7Z8E8
LinkDB
Position
1068232..1070286
AA seq 684 aa
MDKAQAQQRIETLRKEISYHNRQYYVLDDPKITDAEYDALMRELNKLEEQFPELVTEDSP
TRRVGGAPVEGFTKVVHEVPMLSLGNAYSPDEMREFDRRVRELAGGKVRYACELKIDGLA
VSLRYENGVLIQGATRGDGEIGEDITTNIRTIHTVPLRLTEPISLEVRGEAYMPKRAFER
LNQARELRGEPLFANPRNAAAGSLRQLDPKVAAQRRLSVFVYTLARADTGTPPAHSETLQ
WLGALGLPINPETTVLDDIEDVIDYIMSWQSKRHDLPYATDGMVIKVDDIDIQKRLGFTA
KSPRWAIAYKYAAEQAQTQLRSIMLTVGRTGAVTPTAVFDPVALAGTTVTRASLHNEDYI
TEKDIRIGDIIVVQKAGDIIPEVVRVVTERRTGIEKPFSMPKDCPQCHQPLQRLPGEAAW
RCVNPGCPAQTRERIIHFASRDAMNIEGLGEQWVAQLLQENLIVDVADLYILTKEQLLGL
ERMGERSAQNLIDAIEGSKRNSLERLLFGLGIRLVGEKAAKTIARHFGSLDRLRQASIDE
LTAIPEIGPKMAESMVEFFASEAASEAIRRLVQSGVNTEYLGARGNEDANLDKSTPFAGK
TVVLTGTLSVLDRKEAGDLVEQLGGTVTGSVSARTDILIAGEKAGSKLSKALQLIESGQK
PDLEIMDEATFIQILRNEGITVDG
NT seq 2055 nt   +upstreamnt  +downstreamnt
atggataaagcgcaagcccaacagcgcatcgaaacattacgcaaggagatttcttatcac
aatcgtcagtactacgtactcgatgaccccaaaatcacagacgcggagtatgacgcgttg
atgcgagaactgaacaagcttgaagagcagtttcctgaactcgtcacggaggattccccg
actcgacgggtagggggtgcgcctgtggagggctttacgaaggtcgtccatgaggttccc
atgctctcgctcggtaacgcatacagtcctgatgaaatgcgcgagtttgatcgccgtgtg
cgcgaactcgcaggaggcaaggttcgatacgcttgtgagttgaagattgacgggcttgcc
gtgagcttacgatatgaaaacggcgttctcattcagggagctacccgcggggacggcgaa
attggcgaggacatcacaaccaacattcgtaccattcatacggtaccacttcggctgaca
gaacccatttcccttgaagtccgcggtgaggcgtacatgccaaagcgcgctttcgaacgt
ttgaaccaggctcgcgagctgcgcggggaacccttgtttgcgaacccccgtaatgcagca
gccggatcgctgcgccagttggacccgaaggtcgctgcacaaaggcggttgtccgtgttc
gtatacaccttggcccgtgcagatacaggcacaccgcccgctcattccgagacccttcaa
tggcttggcgccctgggcttgcccatcaatccggaaacgaccgtgctcgatgacattgaa
gatgtgattgactacatcatgtcgtggcagtccaagcgccacgacctcccttatgccact
gacggcatggtcattaaggttgacgatatcgacattcagaagcggcttgggttcacagca
aagagcccgcgttgggccattgcgtacaaatacgcagcagaacaggcacaaacgcagttg
cgatccatcatgttgacagtgggacgcacgggggcagtcactcccaccgccgtgttcgat
ccggtcgcactcgcgggtaccacggtgacgcgtgcgtcgctgcataacgaagattacatt
acagagaaggacattcgcatcggcgatatcatcgtggttcaaaaagctggtgatatcatc
ccggaagtggttcgggtagtgacggagcgccggaccggcatcgaaaaaccgttttcaatg
ccaaaggattgcccccagtgtcaccaaccgttgcagcgtctaccaggggaggcagcgtgg
cggtgtgtgaatccaggctgtcccgcacaaactcgcgagcgcattatccattttgcatcc
cgggatgcgatgaacatcgagggccttggagaacagtgggttgcccaactgctgcaggaa
aacttgattgttgacgtggcagacctctacatcctgaccaaggaacaactacttggatta
gaacggatgggagagcgttcggcacagaacctcatcgatgccattgaaggaagcaagcgc
aattcgctggagcgtctgttgtttgggcttggtattcgtctggtgggcgaaaaggcagcg
aagacgattgcccggcacttcggctctcttgacaggctccggcaggcaagcatcgacgaa
ctcacagcaatccctgagattggaccaaagatggcagagagcatggtggagttttttgcc
agtgaagctgcaagcgaggctatacgacgtttggttcaatcgggtgtgaacacagaatac
ctcggggcacgtggaaatgaagacgcaaatctcgacaagagcactccgtttgcgggcaag
accgttgtcttgacgggaacgttgtctgtgctcgatcgtaaggaggctggtgaccttgtc
gaacaacttgggggaaccgtcaccggcagtgtcagtgctcgaacggacatactgattgcg
ggggaaaaggccggttcgaaactcagcaaggcactgcaattgattgagtcaggtcaaaag
cctgacctcgagattatggacgaagcaacgtttattcaaatcctgcgcaacgagggcata
actgtagacggctaa

DBGET integrated database retrieval system