KEGG   Antechinus flavipes (yellow-footed antechinus): 127559172
Entry
127559172         CDS       T08818                                 
Name
(RefSeq) tumor necrosis factor
  KO
K03156  tumor necrosis factor superfamily, member 2
Organism
afz  Antechinus flavipes (yellow-footed antechinus)
Pathway
afz01523  Antifolate resistance
afz04010  MAPK signaling pathway
afz04060  Cytokine-cytokine receptor interaction
afz04061  Viral protein interaction with cytokine and cytokine receptor
afz04064  NF-kappa B signaling pathway
afz04071  Sphingolipid signaling pathway
afz04150  mTOR signaling pathway
afz04210  Apoptosis
afz04217  Necroptosis
afz04350  TGF-beta signaling pathway
afz04380  Osteoclast differentiation
afz04612  Antigen processing and presentation
afz04620  Toll-like receptor signaling pathway
afz04621  NOD-like receptor signaling pathway
afz04622  RIG-I-like receptor signaling pathway
afz04625  C-type lectin receptor signaling pathway
afz04640  Hematopoietic cell lineage
afz04650  Natural killer cell mediated cytotoxicity
afz04657  IL-17 signaling pathway
afz04660  T cell receptor signaling pathway
afz04664  Fc epsilon RI signaling pathway
afz04668  TNF signaling pathway
afz04920  Adipocytokine signaling pathway
afz04930  Type II diabetes mellitus
afz04931  Insulin resistance
afz04932  Non-alcoholic fatty liver disease
afz04933  AGE-RAGE signaling pathway in diabetic complications
afz04936  Alcoholic liver disease
afz04940  Type I diabetes mellitus
afz05010  Alzheimer disease
afz05014  Amyotrophic lateral sclerosis
afz05020  Prion disease
afz05022  Pathways of neurodegeneration - multiple diseases
afz05132  Salmonella infection
afz05133  Pertussis
afz05134  Legionellosis
afz05135  Yersinia infection
afz05140  Leishmaniasis
afz05142  Chagas disease
afz05143  African trypanosomiasis
afz05144  Malaria
afz05145  Toxoplasmosis
afz05146  Amoebiasis
afz05152  Tuberculosis
afz05160  Hepatitis C
afz05161  Hepatitis B
afz05163  Human cytomegalovirus infection
afz05164  Influenza A
afz05165  Human papillomavirus infection
afz05166  Human T-cell leukemia virus 1 infection
afz05168  Herpes simplex virus 1 infection
afz05169  Epstein-Barr virus infection
afz05170  Human immunodeficiency virus 1 infection
afz05171  Coronavirus disease - COVID-19
afz05205  Proteoglycans in cancer
afz05310  Asthma
afz05321  Inflammatory bowel disease
afz05322  Systemic lupus erythematosus
afz05323  Rheumatoid arthritis
afz05330  Allograft rejection
afz05332  Graft-versus-host disease
afz05410  Hypertrophic cardiomyopathy
afz05414  Dilated cardiomyopathy
afz05417  Lipid and atherosclerosis
afz05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:afz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    127559172
   04350 TGF-beta signaling pathway
    127559172
   04064 NF-kappa B signaling pathway
    127559172
   04668 TNF signaling pathway
    127559172
   04071 Sphingolipid signaling pathway
    127559172
   04150 mTOR signaling pathway
    127559172
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    127559172
   04061 Viral protein interaction with cytokine and cytokine receptor
    127559172
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    127559172
   04217 Necroptosis
    127559172
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    127559172
   04620 Toll-like receptor signaling pathway
    127559172
   04621 NOD-like receptor signaling pathway
    127559172
   04622 RIG-I-like receptor signaling pathway
    127559172
   04625 C-type lectin receptor signaling pathway
    127559172
   04650 Natural killer cell mediated cytotoxicity
    127559172
   04612 Antigen processing and presentation
    127559172
   04660 T cell receptor signaling pathway
    127559172
   04657 IL-17 signaling pathway
    127559172
   04664 Fc epsilon RI signaling pathway
    127559172
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    127559172
  09158 Development and regeneration
   04380 Osteoclast differentiation
    127559172
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    127559172
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    127559172
   05170 Human immunodeficiency virus 1 infection
    127559172
   05161 Hepatitis B
    127559172
   05160 Hepatitis C
    127559172
   05171 Coronavirus disease - COVID-19
    127559172
   05164 Influenza A
    127559172
   05168 Herpes simplex virus 1 infection
    127559172
   05163 Human cytomegalovirus infection
    127559172
   05169 Epstein-Barr virus infection
    127559172
   05165 Human papillomavirus infection
    127559172
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    127559172
   05135 Yersinia infection
    127559172
   05133 Pertussis
    127559172
   05134 Legionellosis
    127559172
   05152 Tuberculosis
    127559172
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    127559172
   05144 Malaria
    127559172
   05145 Toxoplasmosis
    127559172
   05140 Leishmaniasis
    127559172
   05142 Chagas disease
    127559172
   05143 African trypanosomiasis
    127559172
  09163 Immune disease
   05310 Asthma
    127559172
   05322 Systemic lupus erythematosus
    127559172
   05323 Rheumatoid arthritis
    127559172
   05321 Inflammatory bowel disease
    127559172
   05330 Allograft rejection
    127559172
   05332 Graft-versus-host disease
    127559172
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    127559172
   05014 Amyotrophic lateral sclerosis
    127559172
   05020 Prion disease
    127559172
   05022 Pathways of neurodegeneration - multiple diseases
    127559172
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    127559172
   05418 Fluid shear stress and atherosclerosis
    127559172
   05410 Hypertrophic cardiomyopathy
    127559172
   05414 Dilated cardiomyopathy
    127559172
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    127559172
   04940 Type I diabetes mellitus
    127559172
   04936 Alcoholic liver disease
    127559172
   04932 Non-alcoholic fatty liver disease
    127559172
   04931 Insulin resistance
    127559172
   04933 AGE-RAGE signaling pathway in diabetic complications
    127559172
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    127559172
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and neuropeptides [BR:afz04052]
    127559172
   00536 Glycosaminoglycan binding proteins [BR:afz00536]
    127559172
Cytokines and neuropeptides [BR:afz04052]
 Cytokines
  Tumor necrosis fators
   127559172
Glycosaminoglycan binding proteins [BR:afz00536]
 Heparan sulfate / Heparin
  Cytokines
   127559172
SSDB
Motif
Pfam: TNF Form-deh_trans
Other DBs
NCBI-GeneID: 127559172
NCBI-ProteinID: XP_051848800
LinkDB
Position
4:189840483..189843137
AA seq 232 aa
MSTESMIRDVELAEEALQRKARGPQGPGRCLCLTLISFLFLAGATILFCLLHFGVIGPQK
EEEQDAFRDMKPLTQRVRSCLSESDKPVAHVVANPKAEGQLQWLNRSANALLNNGMELKD
NQLVVPATGLYLVYSQLLFKGEDCASEPLFLTHTISRVSLSYQHKVSLLAAIKSPCQKAT
QGAREANPWYEPIYLGGVFQLEKGDKLSSDTNYPKYLDLAESGQVYFGIIAL
NT seq 699 nt   +upstreamnt  +downstreamnt
atgagcacagagagcatgatccgagacgtggaactagcagaagaggcactccaaaggaag
gcaagggggccccaaggccctggacgctgcctctgcctcacacttatctccttccttttt
cttgctggggctactattctcttctgcctgctgcacttcggtgtgataggacctcagaag
gaagaggagcaagatgcctttcgtgacatgaaacctttgactcagagagtcagatcttgt
ctcagtgaaagtgacaagcctgtagctcatgttgtagctaatcccaaggcagaggggcag
ctccagtggttgaataggagtgccaatgctctcctgaataatggcatggaactgaaagac
aaccagctggtggtgcctgccactgggctctacctggtctactcccagctccttttcaag
ggagaagattgtgccagcgaacccctgttcctcactcataccatctcccgggtttcattg
tcctaccaacacaaagtcagccttcttgctgccatcaagagtccgtgccagaaggcaaca
caaggagctagggaagctaatccctggtatgaaccaatctacctggggggtgtcttccag
cttgaaaaaggtgataagctcagttctgacaccaactatccaaaatatcttgacttagct
gagtctggccaggtctattttgggatcattgctctttga

DBGET integrated database retrieval system