KEGG   Addendum: AAA33337
Entry
AAA33337          CDS       T10000                                 
Symbol
CYP55A1
Name
(KEGG) nitric oxide reductase [NAD(P)+, nitrous oxide-forming] (EC:1.7.1.14)
  KO
K15877  fungal nitric oxide reductase [EC:1.7.1.14]
Taxonomy
TAX:5507
  Lineage
Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Sordariomycetes; Hypocreomycetidae; Hypocreales; Nectriaceae; Fusarium; Fusarium oxysporum species complex
Organism
ag  Addendum (Fusarium oxysporum)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: AAA33337
GB: M63340
UniProt: P23295
Structure
LinkDB
AA seq 403 aa
MASGAPSFPFSRASGPEPPAEFAKLRATNPVSQVKLFDGSLAWLVTKHKDVCFVATSEKL
SKVRTRQGFPELSASGKQAAKAKPTFVDMDPPEHMHQRSMVEPTFTPEAVKNLQPYIQRT
VDDLLEQMKQKGCANGPVDLVKEFALPVPSYIIYTLLGVPFNDLEYLTQQNAIRTNGSST
AREASAANQELLDYLAILVEQRLVEPKDDIISKLCTEQVKPGNIDKSDAVQIAFLLLVAG
NATMVNMIALGVATLAQHPDQLAQLKANPSLAPQFVEELCRYHTASALAIKRTAKEDVMI
GDKLVRANEGIIASNQSANRDEEVFENPDEFNMNRKWPPQDPLGFGFGDHRCIAEHLAKA
ELTTVFSTLYQKFPDLKVAVPLGKINYTPLNRDVGIVDLPVIF
Reference
PMID:2037602
  Authors
Kizawa H, Tomura D, Oda M, Fukamizu A, Hoshino T, Gotoh O, Yasui T, Shoun H
  Title
Nucleotide sequence of the unique nitrate/nitrite-inducible cytochrome P-450 cDNA from Fusarium oxysporum.
  Journal
J Biol Chem 266:10632-7 (1991)
Reference
  Authors
Oshima R, Fushinobu S, Su F, Zhang L, Takaya N, Shoun H
  Title
Structural evidence for direct hydride transfer from NADH to cytochrome P450nor.
  Journal
J Mol Biol 342:207-17 (2004)
DOI:10.1016/j.jmb.2004.07.009

DBGET integrated database retrieval system