KEGG   Addendum: AAG13921
Entry
AAG13921          CDS       T10000                                 

Symbol
megCIII
Name
(KEGG) L-desosaminyltransferase
  KO
K14368  3-alpha-mycarosylerythronolide B desosaminyl transferase [EC:2.4.1.278]
Taxonomy
TAX:47868
  Lineage
Bacteria; Actinobacteria; Micromonosporales; Micromonosporaceae; Micromonospora
Organism
ag  Addendum (Micromonospora megalomicea)
SSDB
Motif
Pfam: DUF1205 UDPGT Glyco_tran_28_C
Other DBs
NCBI-ProteinID: AAG13921
GB: AF263245
UniProt: Q9F826
LinkDB
AA seq 422 aa
MRVVFSSMASKSHLFGLVPLAWAFRAAGHEVRVVASPALTDDITAAGLTAVPVGTDVDLV
DFMTHAGYDIIDYVRSLDFSERDPATSTWDHLLGMQTVLTPTFYALMSPDSLVEGMISFC
RSWRPDWSSGPQTFAASIAATVTGVAHARLLWGPDITVRARQKFLGLLPGQPAAHREDPL
AEWLTWSVERFGGRVPQDVEELVVGQWTIDPAPVGMRLDTGLRTVGMRYVDYNGPSVVPD
WLHDEPTRRRVCLTLGISSRENSIGQVSVDDLLGALGDVDAEIIATVDEQQLEGVAHVPA
NIRTVGFVPMHALLPTCAATVHHGGPGSWHTAAIHGVPQVILPDGWDTGVRAQRTEDQGA
GIALPVPELTSDQLREAVRRVLDDPAFTAGAARMRADMLAEPSPAEVVDVCAGLVGERTA
VG
Reference
  Authors
Volchegursky Y, Hu Z, Katz L, McDaniel R
  Title
Biosynthesis of the anti-parasitic agent megalomicin: transformation of erythromycin to megalomicin in Saccharopolyspora erythraea.
  Journal
Mol Microbiol 37:752-62 (2000)
DOI:10.1046/j.1365-2958.2000.02059.x

DBGET integrated database retrieval system