KEGG   Addendum: AAM77987
Entry
AAM77987          CDS       T10000                                 
Symbol
ncsB2
Name
(KEGG) 2-hydroxy-7-methoxy-5-methyl-1-naphthoate---CoA ligase (EC:6.2.1.43)
  KO
K20423  2-hydroxy-7-methoxy-5-methyl-1-naphthoate---CoA ligase [EC:6.2.1.43]
Taxonomy
TAX:1897
  Lineage
Bacteria; Actinomycetota; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
Streptomyces carzinostaticus
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-ProteinID: AAM77987
GB: AY117439
UniProt: Q84HC5
LinkDB
AA seq 558 aa
MHETAAAPAPAGFVPWPDDVAARYTAAGHWEGRSLGTHLAEAARKVPEAVCLVDGPVRMS
YSELMARADGAAVRMRGLGIRPADRVVVQLPNCWEHVVVTMACLRLGALPIWALPQYRHR
ELSGVVTHARASALVVPDVYREFDHQALAHEVAEAQPTVRHVLVAGSDVRPDSVDLRALC
EPLDADEAARVAAELDRSAPRGEEVAMLKLSGGTTGLPKLVARTHNDLSYMIKRAAQVCG
FGRDTVYLAVLPLGHGFPNTGPGVLGTLLAGGRVVISGSPAPEAAFALMERERVTATSVV
PAIVMRWLQYRDERPGADLGSLELMQVGASRLEPEVARQVGPKLGCRLQQVFGMAEGLLC
LTRLDDPDDVVHYTQGRPISPDDEIRVVDPEGRTVGVGEPGALLTRGPYTPRGYYDSPSA
NARAFTPDGWYRTGDLVRRTPDGNLIVVGREKDLINRGGEKINAEEVEGFAVQVDGVLQA
AAVGLPDSELGERICLFVVLADGTRVELADVRKVMENAETASFKLPERLITLPSLPTTPM
GKIDKKALRAAAGRMSET
Reference
  Authors
Liu W, Nonaka K, Nie L, Zhang J, Christenson SD, Bae J, Van Lanen SG, Zazopoulos E, Farnet CM, Yang CF, Shen B
  Title
The neocarzinostatin biosynthetic gene cluster from Streptomyces carzinostaticus ATCC 15944 involving two iterative type I polyketide synthases.
  Journal
Chem Biol 12:293-302 (2005)
DOI:10.1016/j.chembiol.2004.12.013
Reference
  Authors
Cooke HA, Zhang J, Griffin MA, Nonaka K, Van Lanen SG, Shen B, Bruner SD
  Title
Characterization of NcsB2 as a promiscuous naphthoic acid/coenzyme A ligase integral to the biosynthesis of the enediyne antitumor antibiotic neocarzinostatin.
  Journal
J Am Chem Soc 129:7728-9 (2007)
DOI:10.1021/ja071886a

DBGET integrated database retrieval system