| Entry |
|
|---|
| Symbol |
cloN1
|
|---|
| Name |
(KEGG) clorobiocin biosynthesis protein CloN1
|
|---|
| KO |
| K17626 | clorobiocin biosynthesis protein CloN1 |
|
|---|
| Taxonomy |
|
|---|
| Lineage |
Bacteria; Bacillati; Actinomycetota; Actinomycetes; Kitasatosporales; Streptomycetaceae; Streptomyces |
|---|
| Organism |
Streptomyces roseochromogenus
|
|---|
| SSDB |
|
|---|
| Motif |
|
|---|
| Other DBs |
|
|---|
| LinkDB |
|
|---|
| AA seq |
95 aa
MVSGPTELEHVLTRLEILLNDVWDQRPAGAATSATAPLVSLGVDSLTLALLLDKVGREFH
IDWTADTPPGAASSLRSIADLVLRRDGGGATAAEA |
|---|
| Reference |
|
|---|
| Authors |
Pojer F, Li SM, Heide L. |
|---|
| Title |
Molecular cloning and sequence analysis of the clorobiocin biosynthetic gene cluster: new insights into the biosynthesis of aminocoumarin antibiotics. |
|---|
| Journal |
|
|---|
