KEGG   Addendum: AAS92554
Entry
AAS92554          CDS       T10000                                 
Symbol
SIRD
Name
(KEGG) 4-O-dimethylallyl-L-tyrosine synthase (EC:2.5.1.122)
  KO
K21339  4-O-dimethylallyl-L-tyrosine synthase [EC:2.5.1.122]
Taxonomy
TAX:5022
  Lineage
Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Dothideomycetes; Pleosporomycetidae; Pleosporales; Pleosporineae; Leptosphaeriaceae; Leptosphaeria; Leptosphaeria maculans species complex
Organism
ag  Addendum (Leptosphaeria maculans)
SSDB
Motif
Pfam: Trp_DMAT
Other DBs
NCBI-ProteinID: AAS92554
GB: AY553235
UniProt: Q6Q874
LinkDB
AA seq 448 aa
MQTARLFQGNLNLAAANIRDYEKKEQRNLGVWLSLNQWLRLYDEDTRFWWTTTAPMLGRM
MELIGYDQDAQQKHLLFYYIYVLPSLGRRPSPEGYPTGWNSFMTDDYSPLELSWDWGVAE
GESSVRFSIEPIGKYAGTQADPLNQKMVYQLVDGLRPAFHHTLDLTLFDVFSEALTTSRE
KFGTRKLSLEGRSQYFVAFDLDVGHPRLKAYFMPGLKSIESNTPVSELVVKAMDACELHF
GSLFMQAFRRLNSDLEAFSATSYHRPEIEIVGIDCVSPVKSRAKIYIRHRGTSFDSVCRM
LSMGAKAPLDAASVASLRELWALVLGLPKDFPSDQELPSVPHRTSGVLYYFEIKPTSDAI
VPKVYIPVRHYASNDLSIAQGLATYFERRGQTVAAENYVDALSDIFSHRSLDSGLGLHTY
ISCTFKKTGLSVTSYFNPEIYHPNRYRQ
Reference
  Authors
Gardiner DM, Cozijnsen AJ, Wilson LM, Pedras MS, Howlett BJ
  Title
The sirodesmin biosynthetic gene cluster of the plant pathogenic fungus Leptosphaeria maculans.
  Journal
Mol Microbiol 53:1307-18 (2004)
DOI:10.1111/j.1365-2958.2004.04215.x
Reference
  Authors
Kremer A, Li SM
  Title
A tyrosine O-prenyltransferase catalyses the first pathway-specific step in the biosynthesis of sirodesmin PL.
  Journal
Microbiology 156:278-86 (2010)
DOI:10.1099/mic.0.033886-0
Reference
  Authors
Zou HX, Xie X, Zheng XD, Li SM
  Title
The tyrosine O-prenyltransferase SirD catalyzes O-, N-, and C-prenylations.
  Journal
Appl Microbiol Biotechnol 89:1443-51 (2011)
DOI:10.1007/s00253-010-2956-x

DBGET integrated database retrieval system