KEGG   Addendum: ABV68925
Entry
ABV68925          CDS       T10000                                 
Symbol
UGT85A19
Name
(KEGG) (R)-mandelonitrile beta-glucosyltransferase (EC:2.4.1.354)
  KO
K22706  (R)-mandelonitrile beta-glucosyltransferase [EC:2.4.1.354]
Taxonomy
TAX:3755
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Amygdaloideae; Amygdaleae; Prunus
Organism
ag  Addendum (Prunus dulcis)
SSDB
Motif
Pfam: UDPGT
Other DBs
NCBI-ProteinID: ABV68925
GB: EU015987
UniProt: B2XBQ5
LinkDB
AA seq 483 aa
MSPVASKEKPHAVFVPFPAQGHINPMLQLAKLLNYKGFHITFVNTEFNHKRMLESQGSHA
LDGLPSFRFETIPDGLPPADADARRNLPLVCDSTSKTCLAPFEALLTKLNSSPDSPPVTC
IVADGVSSFTLDAAEHFGIPEVLFWTTSACGLMGYVQYYRLIEKGLTPFKDAKDFANGYL
DTEIDWIPGMKDVRLKDMPSFIRTTDPNDIMLHYMVSETERSKKASAIILNTFDALEQEV
VDALSTLLPPIYSIGPLQLPYSEIPSEYNDLKAIGSNLWAENTECLNWLDTKEPNSVVYV
NFGSTTVMTNEQLVEFSWGLANSKKPFLWIIRPGLVAGETAVVPPEFLEETKERGMLASW
CPQEQVLLHSAIGGFLTHSGWNSTLEALCGGVPLICWPFFAEQQTNVRYSCTQWGIGIEI
DGEVKRDYIDGLVRTLMDGEEGKKMRKKALEWKKLAEDATSPKGSSYLALENVVSKVLLS
PRD
Reference
  Authors
Franks TK, Yadollahi A, Wirthensohn MG, Guerin JR, Kaiser BN, Sedgley M, Ford CM
  Title
A seed coat cyanohydrin glucosyltransferase is associated with bitterness in almond (Prunus dulcis) kernels.
  Journal
Funct Plant Biol 35:236-246 (2008)
DOI:10.1071/FP07275

DBGET integrated database retrieval system