KEGG   Addendum: ADD85331
Entry
ADD85331          CDS       T10000                                 

Gene name
CODM
Definition
(KEGG) codeine 3-O-demethylase (EC:1.14.11.32)
  KO
K14975  codeine 3-O-demethylase [EC:1.14.11.32]
Taxonomy
TAX:3469
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; Ranunculales; Papaveraceae; Papaveroideae; Papaver
Organism
ag  Addendum (Papaver somniferum)
SSDB
Motif
Pfam: 2OG-FeII_Oxy DIOX_N
Other DBs
NCBI-ProteinID: ADD85331
GB: GQ500141
UniProt: D4N502
LinkDB
AA seq 360 aa
METPILIKLGNGLSIPSVQELAKLTLAEIPSRYTCTGESPLNNIGASVTDDETVPVIDLQ
NLLSPEPVVGKLELDKLHSACKEWGFFQLVNHGVDALLMDNIKSEIKGFFNLPMNEKTKY
GQQDGDFEGFGQPYIESEDQRLDWTEVFSMLSLPLHLRKPHLFPELPLPFRETLESYLSK
MKKLSTVVFEMLEKSLQLVEIKGMTDLFEDGLQTMRMNYYPPCPRPELVLGLTSHSDFSG
LTILLQLNEVEGLQIRKEERWISIKPLPDAFIVNVGDILEIMTNGIYRSVEHRAVVNSTK
ERLSIATFHDSKLESEIGPISSLVTPETPALFKRGRYEDILKENLSRKLDGKSFLDYMRM
Reference
  Authors
Hagel JM, Facchini PJ
  Title
Dioxygenases catalyze the O-demethylation steps of morphine biosynthesis in opium poppy.
  Journal
Nat Chem Biol 6:273-5 (2010)
DOI:10.1038/nchembio.317

DBGET integrated database retrieval system