KEGG   Addendum: ADJ19200
Entry
ADJ19200          CDS       T10000                                 
Symbol
lea7
Name
(KEGG) 5-N-acetyl-7-N-(D-alanyl)-legionaminic acid cytidylyltransferase
  KO
K24307  5-N-acetyl-7-N-(D-alanyl)-legionaminic acid cytidylyltransferase
Taxonomy
TAX:562
  Lineage
Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Escherichia
Organism
Escherichia coli
SSDB
Motif
Pfam: CTP_transf_3 NTP_transf_3 IspD
Other DBs
NCBI-ProteinID: ADJ19200
GB: GU220361
UniProt: D8WNA3
LinkDB
AA seq 233 aa
MSILAIIPARANSKRLPNKNILKLAGKPLIKWTIDSALQCNDISKVMVSTDSPKIAELAT
QFGADVPYLRCAELSGDTASSYDVVIDAISYYRKTGKEFKDILLLQPTSPLRDVKDINNA
ISLYRKRDANAVVSVVECEHSPLWCNTLPDSLRMDNFINDEIKKTRSQDLPKYYQINGAI
YLIKTESLLREKTFIPKKTFALIMSKKNSVDIDDYYDFLRAEVFCNEDKRSFL
Reference
  Authors
Li X, Perepelov AV, Wang Q, Senchenkova SN, Liu B, Shevelev SD, Guo X, Shashkov AS, Chen W, Wang L, Knirel YA
  Title
Structural and genetic characterization of the O-antigen of Escherichia coli O161 containing a derivative of a higher acidic diamino sugar, legionaminic acid.
  Journal
Carbohydr Res 345:1581-7 (2010)
DOI:10.1016/j.carres.2010.04.008

DBGET integrated database retrieval system