KEGG   Addendum: ADU77278
Entry
ADU77278          CDS       T10000                                 

Symbol
dmoA
Name
(KEGG) dimethyl-sulfide monooxygenase (EC:1.14.13.131)
  KO
K16967  dimethyl-sulfide monooxygenase [EC:1.14.13.131]
Taxonomy
TAX:121290
  Lineage
Bacteria; Proteobacteria; Alphaproteobacteria; Hyphomicrobiales; Hyphomicrobiaceae; Hyphomicrobium
Organism
ag  Addendum (Hyphomicrobium sulfonivorans)
SSDB
Motif
Pfam: Bac_luciferase TPR_MalT Amidohydro_2
Other DBs
NCBI-ProteinID: ADU77278
GB: GQ980036
UniProt: E9JFX9
LinkDB
Structure
PDB: 
6AK1

AA seq 480 aa
MKKRIVLNAFDMTCVSHQSAGTWRHPSSQAARYNDLEYWTNMAMELERGCFDCLFIADVV
GVYDVYRGSAEMALRDADQVPVNDPFGAISAMAAVTEHVGFGVTAAITFEQPYLLARRLS
TLDHLTKGRVAWNVVSSYLNSAALNIGMDQQLAHDERYEMADEYMEVMYKLWEGSWEDDA
VKRDKKSGVFTDGSKVHPINHQGKYYKVPGFHICEPSPQRTPVIFQAGASGRGSKFAASN
AEGMFILTTSVEQARQITTDIRNQAEAAGRSRDSIKIFMLLTVITGDSDEAAEAKYQEYL
SYANPEGMLALYGGWTGIDFAKLDPDEPLQAMENDSLRTTLESLTHGENAKKWTVRDVIR
ERCIGGLGPVLVGGPQKVADELERWVDEGGVDGFNLAYAVTPGSVTDFIDYIVPELRKRG
RAQDSYKPGSLRRKLIGTNDGRVESTHPAAQYRDAYVGKESVADRTQPSPFANAKAPVAE
Reference
  Authors
Boden R, Borodina E, Wood AP, Kelly DP, Murrell JC, Schafer H
  Title
Purification and characterization of dimethylsulfide monooxygenase from Hyphomicrobium sulfonivorans.
  Journal
J Bacteriol 193:1250-8 (2011)
DOI:10.1128/JB.00977-10

DBGET integrated database retrieval system