KEGG   Addendum: AEM62998
Entry
AEM62998          CDS       T10000                                 
Symbol
acrC
Name
(KEGG) acrylyl-CoA reductase (NADH) (EC:1.3.1.95)
  KO
K20143  acrylyl-CoA reductase (NADH) [EC:1.3.1.95]
Taxonomy
TAX:28446
  Lineage
Bacteria; Bacillota; Clostridia; Eubacteriales; Lachnospiraceae; Anaerotignum
Organism
Anaerotignum propionicum
SSDB
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_M Acyl-CoA_dh_2 DUF1249
Other DBs
NCBI-ProteinID: AEM62998
GB: JN244656
UniProt: G3KIM8
LinkDB
AA seq 394 aa
MFLLKIKKERMKRMDFSLTREQEMLKKLARQFAEIELEPVAEEIDREHVFPAENFKKMAE
IGLTGIGIPKEFGGSGGGTLEKVIAVSEFGKKCMASASILSIHLIAPQAIYKYGTKEQKE
TYLPRLTKGGELGAFALTEPNAGSDAGAVKTTAILDSQTNEYVLNGTKCFISGGGRAGVL
VIFALTEPKKGLKGMSAIIVEKGTPGFSIGKVESKMGIAGSETAELIFEDCRVPAANLLG
KEGKGFKIAMEALDGARIGVGAQAIGIAEGAIDLSVKYVHERIQFGKPIANLQGIQWYIA
DMATKTAAARALVEFAAYLEDAGKPFTKESAMCKLNASENARFVTNLALQIHGGYGYMKD
YPLERMYRDAKITEIYEGTSEIHKVVIAREVMKR
Reference
  Authors
Kandasamy V, Vaidyanathan H, Djurdjevic I, Jayamani E, Ramachandran KB, Buckel W, Jayaraman G, Ramalingam S
  Title
Engineering Escherichia coli with acrylate pathway genes for propionic acid synthesis and its impact on mixed-acid fermentation.
  Journal
Appl Microbiol Biotechnol 97:1191-200 (2013)
DOI:10.1007/s00253-012-4274-y

DBGET integrated database retrieval system