KEGG   Addendum: AFN42527
Entry
AFN42527          CDS       T10000                                 
Symbol
OAC
Name
(KEGG) olivetolic acid cyclase (EC:4.4.1.26)
  KO
K20508  olivetolic acid cyclase [EC:4.4.1.26]
Taxonomy
TAX:3483
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Organism
Cannabis sativa
Module
3483_M00894  Cannabidiol biosynthesis, malonyl-CoA => cannabidiol/dronabinol
SSDB
Motif
Pfam: Dabb FAD_syn DrrA_P4M
Other DBs
NCBI-ProteinID: AFN42527
GB: JN679224
UniProt: I6WU39
Structure
LinkDB
AA seq 101 aa
MAVKHLIVLKFKDEITEAQKEEFFKTYVNLVNIIPAMKDVYWGKDVTQKNKEEGYTHIVE
VTFESVETIQDYIIHPAHVGFGDVYRSFWEKLLIFDYTPRK
Reference
  Authors
Gagne SJ, Stout JM, Liu E, Boubakir Z, Clark SM, Page JE
  Title
Identification of olivetolic acid cyclase from Cannabis sativa reveals a unique catalytic route to plant polyketides.
  Journal
Proc Natl Acad Sci U S A 109:12811-6 (2012)
DOI:10.1073/pnas.1200330109

DBGET integrated database retrieval system