KEGG   Addendum: BAA07388
Entry
BAA07388          CDS       T10000                                 

Symbol
cts6
Name
(KEGG) N,N-dimethyltransferase
  KO
K14255  4-amino-anhydrotetracycline N4-methyltransferase [EC:2.1.1.335]
Taxonomy
TAX:1894
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Kitasatospora
Organism
ag  Addendum (Kitasatospora aureofaciens)
SSDB
Motif
Pfam: Methyltransf_2 Methyltransf_25 Methyltransf_12 Methyltransf_23 Methyltransf_11 Methyltransf_31
Other DBs
NCBI-ProteinID: BAA07388
GB: D38214
UniProt: Q53658
LinkDB
AA seq 292 aa
MTSSTDSAAARARRIVALNTAYFQAKALQSAVELAREFLLPGPTYLGGTARQHARLHYHA
WAQLTDALRDGKAKSAEAATGTLAYPKQYEDLDRARQIMLHMDAHNGFTADELARAIDWS
RYTSFVDVGGGRGNVASRIVTAHPHLRGGVFDLPALRPLFEELVASAGTADRVDFHGGDF
FATDLPEADVVIFGHVLPDWPVGDRRELLRRAHKAVRPGGLVVLYDAMIDPEERDPEVLL
QRINHTMIRDEAGAYSLQEARAYLEEAGFTVDRIAASDTITRDHFAIGVKSV
Reference
PMID:7612997
  Authors
Dairi T, Nakano T, Aisaka K, Katsumata R, Hasegawa M.
  Title
Cloning and nucleotide sequence of the gene responsible for chlorination of tetracycline.
  Journal
Biosci Biotechnol Biochem 59:1099-106 (1995)
DOI:10.1271/bbb.59.1099

DBGET integrated database retrieval system