KEGG   Addendum: BAE07071
Entry
BAE07071          CDS       T10000                                 
Symbol
btrG
Name
(KEGG) gamma-L-glutamyl-butirosin B gamma-glutamyl cyclotransferase (EC:4.3.2.6)
  KO
K13564  gamma-L-glutamyl-butirosin B gamma-L-glutamyl cyclotransferase [EC:4.3.2.6]
Taxonomy
TAX:1397
  Lineage
Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Niallia
Organism
ag  Addendum (Niallia circulans)
SSDB
Motif
Pfam: GGACT
Other DBs
NCBI-ProteinID: BAE07071
GB: AB097196
UniProt: Q4H4F0
LinkDB
AA seq 156 aa
MISWTKAFTKPLKGRIFMPNLFVYGTLREGENNHKYMKEATLLSRKASIAGSLVDTGNGY
PGLLLENQLVAGEWYEVSEETLKRIDELEEYFGPGDTRNLFDRIECQVNESGGTHLGWTY
VYNRDDYLETRFSDWKQYRLQHASGIEEKQDVPHSL
Reference
  Authors
Kudo F, Numakura M, Tamegai H, Yamamoto H, Eguchi T, Kakinuma K
  Title
Extended sequence and functional analysis of the butirosin biosynthetic gene cluster in Bacillus circulans SANK 72073.
  Journal
J Antibiot (Tokyo) 58:373-9 (2005)
DOI:10.1038/ja.2005.47
Reference
  Authors
Llewellyn NM, Li Y, Spencer JB
  Title
Biosynthesis of butirosin: transfer and deprotection of the unique amino acid side chain.
  Journal
Chem Biol 14:379-86 (2007)
DOI:10.1016/j.chembiol.2007.02.005

DBGET integrated database retrieval system