| Entry |
|
|---|
| Symbol |
dfrB3, dfr2c
|
|---|
| Name |
(KEGG) dihydrofolate reductase DfrB3
|
|---|
| KO |
| K19645 | dihydrofolate reductase (trimethoprim resistance protein) [EC:1.5.1.3] |
|
|---|
| Taxonomy |
|
|---|
| Lineage |
Bacteria; Pseudomonadati; Pseudomonadota; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Klebsiella/Raoultella group; Klebsiella |
|---|
| Organism |
Klebsiella aerogenes
|
|---|
| SSDB |
|
|---|
| Motif |
|
|---|
| Other DBs |
|
|---|
| LinkDB |
|
|---|
| AA seq |
78 aa
MDQHNNGVSTLVAGQFALPSHATFGLGDRVRKKSGAAWQGQVVGWYCTKLTPEGYAVESE
SHPGSVQIYPVAALERVA |
|---|
| Reference |
|
|---|
| Authors |
Radstrom P, Skold O, Swedberg G, Flensburg J, Roy PH, Sundstrom L |
|---|
| Title |
Transposon Tn5090 of plasmid R751, which carries an integron, is related to Tn7, Mu, and the retroelements. |
|---|
| Journal |
|
|---|
