KEGG   Addendum: CAS12253
Entry
CAS12253          CDS       T10000                                 
Symbol
APO1
Name
(KEGG) unspecific peroxygenase (EC:1.11.2.1)
  KO
K21820  unspecific peroxygenase [EC:1.11.2.1]
Taxonomy
  Lineage
Eukaryota; Fungi; Dikarya; Basidiomycota; Agaricomycotina; Agaricomycetes; Agaricomycetidae; Agaricales; Bolbitiaceae; Cyclocybe
Organism
ag  Addendum (Cyclocybe aegerita)
SSDB
Motif
Pfam: Peroxidase_2 TPD
Other DBs
NCBI-ProteinID: CAS12253
GB: FM872457
UniProt: B9W4V6
Structure
LinkDB
AA seq 371 aa
MKYFPLFPTLVFAARVVAFPAYASLAGLSQQELDAIIPTLEAREPGLPPGPLENSSAKLV
NDEAHPWKPLRPGDIRGPCPGLNTLASHGYLPRNGVATPVQIINAVQEGLNFDNQAAVFA
TYAAHLVDGNLITDLLSIGRKTRLTGPDPPPPASVGGLNEHGTFEGDASMTRGDAFFGNN
HDFNETLFEQLVDYSNRFGGGKYNLTVAGELRFKRIQDSIATNPNFSFVDFRFFTAYGET
TFPANLFVDGRRDDGQLDMDAARSFFQFSRMPDDFFRAPSPRSGTGVEVVIQAHPMQPGR
NVGKINSYTVDPTSSDFSTPCLMYEKFVNITVKSLYPNPTVQLRKALNTNLDFFFQGVAA
GCTQVFPYGRD
Reference
  Authors
Pecyna MJ, Ullrich R, Bittner B, Clemens A, Scheibner K, Schubert R, Hofrichter M
  Title
Molecular characterization of aromatic peroxygenase from Agrocybe aegerita.
  Journal
Appl Microbiol Biotechnol 84:885-97 (2009)
DOI:10.1007/s00253-009-2000-1
Reference
  Authors
Kluge M, Ullrich R, Dolge C, Scheibner K, Hofrichter M
  Title
Hydroxylation of naphthalene by aromatic peroxygenase from Agrocybe aegerita proceeds via oxygen transfer from H2O2 and intermediary epoxidation.
  Journal
Appl Microbiol Biotechnol 81:1071-6 (2009)
DOI:10.1007/s00253-008-1704-y

DBGET integrated database retrieval system