Anopheles gambiae (malaria mosquito): 1274908 Help Entry 1274908           CDS       T01036                                  Name (RefSeq) RING-box protein 1A   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism aga  Anopheles gambiae (malaria mosquito) Pathway aga03420   Nucleotide excision repair aga04120   Ubiquitin mediated proteolysis aga04141   Protein processing in endoplasmic reticulum aga04310   Wnt signaling pathway aga04341   Hedgehog signaling pathway - fly aga04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:aga00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     1274908    04120 Ubiquitin mediated proteolysis     1274908   09124 Replication and repair    03420 Nucleotide excision repair     1274908  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     1274908    04341 Hedgehog signaling pathway - fly     1274908    04350 TGF-beta signaling pathway     1274908  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:aga04121]     1274908    03400 DNA repair and recombination proteins [BR:aga03400]     1274908 Enzymes [BR:aga01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      1274908 Ubiquitin system [BR:aga04121]  Ubiquitin ligases (E3)   UBL E3 ligases    1274908   Multi subunit type E3    SCF complex     Ring finger protein      1274908    Cul2 complex      1274908    Cul3 complex      1274908    Cul4 complex      1274908    Cul7 complex      1274908    Cul8 complex      1274908    Cul9 complex      1274908 DNA repair and recombination proteins [BR:aga03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       1274908     TCR (transcription coupled repair) factors      Cul4-CSA complex       1274908 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 Hydant_A_C zf-RING_16 Motif Other DBs NCBI-GeneID:  1274908 NCBI-ProteinID:  XP_314102 UniProt:  Q7Q9J7 LinkDB All DBs Position 2:81091673..81092512 Genome browser AA seq 109 aa AA seqDB search MDIDEEEFEAPTSSSSRGERKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQAN QASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 330 nt NT seq  +upstreamnt  +downstreamnt atggatatcgacgaggaagagttcgaggcaccgacgtccagcagcagccgaggtgagcgg aagcggttcgaggtcaagaagtggaacgcggtagccttgtgggcctgggacatcgtggtg gacaactgtgcgatttgccgaaatcacatcatggatctgtgcatcgagtgccaggcgaac caagcgtccgccaccagtgaggaatgcacggtggcttggggtgtgtgtaatcatgcgttc cacttccactgcatctcccgatggctgaagacccggcaggtctgtccgctcgacaacaga gagtgggagttccagaagtacggtcattag

DBGET integrated database retrieval system