Astur gentilis (Northern goshawk): 126034696 Help Entry 126034696         CDS       T08649                                  Name (RefSeq) glycoprotein hormone alpha-2   KO K25483   glycoprotein hormone alpha-2 Organism agen  Astur gentilis (Northern goshawk) Pathway agen04080   Neuroactive ligand-receptor interaction Brite KEGG Orthology (KO) [BR:agen00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     126034696  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:agen04052]     126034696 Cytokines and neuropeptides [BR:agen04052]  Neuropeptides   GPCR binding    126034696 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cys_knot FST_N DAN Motif Other DBs NCBI-GeneID:  126034696 NCBI-ProteinID:  XP_049648623 LinkDB All DBs Position 35:5996534..5998093 Genome browser AA seq 80 aa AA seqDB search MAAFLLLLLLLLLPPALPDRPPPRLPPPVRRPRTSHARCCTIARAHKVWVTLRCPGGSRR RLQTVSAGACRCDMCRLSRY NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggccgccttcctcctcctcctcctcctcctgctgctgcccccggccctgcccgaccga ccccccccccgcctgccgcctccagtccgccgcccccgcacctcccacgcccgctgctgc accatcgcccgcgcgcacaaggtgtgggtgaccctccggtgtcccgggggctcccgccgg cgcctgcagaccgtctcagccggcgcctgccgctgcgacatgtgccgcctctcccgctac tga

DBGET integrated database retrieval system