Astur gentilis (Northern goshawk): 126047828 Help Entry 126047828         CDS       T08649                                  Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism agen  Astur gentilis (Northern goshawk) Pathway agen03420   Nucleotide excision repair agen04110   Cell cycle agen04114   Oocyte meiosis agen04120   Ubiquitin mediated proteolysis agen04141   Protein processing in endoplasmic reticulum agen04310   Wnt signaling pathway agen04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:agen00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     126047828    04120 Ubiquitin mediated proteolysis     126047828   09124 Replication and repair    03420 Nucleotide excision repair     126047828  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     126047828    04350 TGF-beta signaling pathway     126047828  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     126047828    04114 Oocyte meiosis     126047828  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:agen04121]     126047828    03400 DNA repair and recombination proteins [BR:agen03400]     126047828 Enzymes [BR:agen01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      126047828 Ubiquitin system [BR:agen04121]  Ubiquitin ligases (E3)   UBL E3 ligases    126047828   Multi subunit type E3    SCF complex     Ring finger protein      126047828    Cul2 complex      126047828    Cul3 complex      126047828    Cul4 complex      126047828    Cul7 complex      126047828    Cul8 complex      126047828    Cul9 complex      126047828 DNA repair and recombination proteins [BR:agen03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       126047828     TCR (transcription coupled repair) factors      Cul4-CSA complex       126047828 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  126047828 NCBI-ProteinID:  XP_049677979 LinkDB All DBs Position 18:28649862..28662115 Genome browser AA seq 108 aa AA seqDB search MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcggccgcgatggatgtggatacccctagcggcaccaacagcggcgccggcaagaag cgcttcgaagtgaagaaatggaacgcagtagctctgtgggcatgggacattgtggttgat aactgtgccatttgcagaaaccatattatggatctatgcatagaatgtcaagcaaaccaa gcatcagctacctctgaagagtgcacagtcgcgtggggcgtctgcaaccacgctttccac ttccactgcatctctcgctggctcaaaactcgccaagtatgtccgctggacaacagggaa tgggagttccaaaagtatggacactag

DBGET integrated database retrieval system