Alnus glutinosa (common alder): 133857147 Help Entry 133857147         CDS       T10577                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism aglu  Alnus glutinosa (common alder) Pathway aglu03420   Nucleotide excision repair aglu04120   Ubiquitin mediated proteolysis aglu04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:aglu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     133857147    04120 Ubiquitin mediated proteolysis     133857147   09124 Replication and repair    03420 Nucleotide excision repair     133857147  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:aglu04121]     133857147    03400 DNA repair and recombination proteins [BR:aglu03400]     133857147 Enzymes [BR:aglu01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      133857147 Ubiquitin system [BR:aglu04121]  Ubiquitin ligases (E3)   UBL E3 ligases    133857147   Multi subunit type E3    SCF complex     Ring finger protein      133857147    Cul2 complex      133857147    Cul3 complex      133857147    Cul4 complex      133857147    Cul7 complex      133857147    Cul8 complex      133857147    Cul9 complex      133857147 DNA repair and recombination proteins [BR:aglu03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       133857147     TCR (transcription coupled repair) factors      Cul4-CSA complex       133857147 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  133857147 NCBI-ProteinID:  XP_062148266 LinkDB All DBs Position 14:7000595..7003412 Genome browser AA seq 118 aa AA seqDB search MATLDSDVPMVPVGEPSSSAGPSSSSKKNKRFEIKKWNAVALWAWDIVVDNCAICRNHIM DLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggccaccttggactccgacgtgcccatggtcccagttggcgagccttcgagcagcgcc ggtccttcctcctcctccaagaagaacaagcgcttcgagatcaagaagtggaacgccgta gccctctgggcctgggatattgtagttgataactgtgcgatttgcaggaaccatattatg gatctctgcattgagtgccaagcaaaccaggccagcgccacgagcgaggaatgtacagtt gcttggggtgtttgcaaccatgcctttcattttcactgcatcagccgatggctcaaaacc cgtcaagtgtgtccactagataacagcgagtgggagtttcagaagtatggtcactag

DBGET integrated database retrieval system