Alnus glutinosa (common alder): 133857303 Help Entry 133857303         CDS       T10577                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism aglu  Alnus glutinosa (common alder) Pathway aglu03420   Nucleotide excision repair aglu04120   Ubiquitin mediated proteolysis aglu04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:aglu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     133857303    04120 Ubiquitin mediated proteolysis     133857303   09124 Replication and repair    03420 Nucleotide excision repair     133857303  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:aglu04121]     133857303    03400 DNA repair and recombination proteins [BR:aglu03400]     133857303 Enzymes [BR:aglu01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      133857303 Ubiquitin system [BR:aglu04121]  Ubiquitin ligases (E3)   UBL E3 ligases    133857303   Multi subunit type E3    SCF complex     Ring finger protein      133857303    Cul2 complex      133857303    Cul3 complex      133857303    Cul4 complex      133857303    Cul7 complex      133857303    Cul8 complex      133857303    Cul9 complex      133857303 DNA repair and recombination proteins [BR:aglu03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       133857303     TCR (transcription coupled repair) factors      Cul4-CSA complex       133857303 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  133857303 NCBI-ProteinID:  XP_062148502 LinkDB All DBs Position 14:complement(680327..682623) Genome browser AA seq 118 aa AA seqDB search MATLDLDVPMVPVGEPSGSAGPSSSSKKNKRFEIKKWNAVALWAWDIVVDNCAICRNHIM DLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggccaccttggacctcgacgttcccatggtcccggttggcgagccttcgggcagcgcc ggtccttcctcctcctccaagaagaacaagcgcttcgagatcaagaagtggaacgccgta gccctctgggcctgggatattgtagttgataactgtgcgatttgcaggaaccatattatg gatctctgcattgagtgccaagcaaaccaggccagcgccacgagcgaggaatgtacagtt gcttggggggtttgcaaccatgcctttcattttcactgcatcagccgatggctcaaaacc cgtcaagtgtgtccactagataacagcgagtgggagtttcagaagtatggtcactag

DBGET integrated database retrieval system