Agarivorans sp. B2Z047: LQZ07_22130 Help Entry LQZ07_22130       CDS       T08685                                  Symbol folA Name (GenBank) type 3 dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism agq  Agarivorans sp. B2Z047 Pathway agq00670   One carbon pool by folate agq00790   Folate biosynthesis agq01100   Metabolic pathways agq01240   Biosynthesis of cofactors agq04981   Folate transport and metabolism Module agq_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:agq00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     LQZ07_22130 (folA)    00670 One carbon pool by folate     LQZ07_22130 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     LQZ07_22130 (folA) Enzymes [BR:agq01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      LQZ07_22130 (folA) SSDB OrthologParalogGFIT Motif Pfam:  DHFR_1 ADH_zinc_N Peptidase_S51 Motif Other DBs NCBI-ProteinID:  UQN42443 LinkDB All DBs Position complement(4797353..4797838) Genome browser AA seq 161 aa AA seqDB search MKVAMIAAMAKQRVIGKDNQMPWHLPADLKHFKAVTMGKSVIMGRLTYQSIGRPLPGRLN IVVSRNVDLVIEGVTVVNTVQAALDLVKDEAEVMVIGGGNIYQQCLAFADTLYLTFIEKE VEGDAHFPDYQKYQWQQLASEKHLADEKNPYNYEFVTLERV NT seq 486 nt NT seq  +upstreamnt  +downstreamnt gtgaaagtagcaatgatagccgcaatggcaaagcaacgagtcatcggcaaagataaccaa atgccttggcatttaccggctgatcttaagcattttaaagcggttactatgggcaagtcg gttattatggggcgcttaacttatcagtctattggtcgcccactgccgggtcgattaaat atagtggtaagtcgcaatgtggatttagtcatagagggggttacggtagttaacaccgtt caggcggctttagatttagttaaagacgaagccgaggtgatggttattggtggcggaaat atttaccaacagtgtttagcgtttgccgataccctgtatttaacctttattgaaaaagag gtggaaggagacgcccacttcccagattaccaaaagtatcaatggcaacaacttgctagc gaaaagcacctagctgatgagaaaaatccttacaactatgagtttgttaccttagagcgc gtttag

DBGET integrated database retrieval system