Aphis gossypii (cotton aphid): 114120761 Help Entry 114120761         CDS       T05869                                  Name (RefSeq) RING-box protein 1A   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism ags  Aphis gossypii (cotton aphid) Pathway ags03420   Nucleotide excision repair ags04120   Ubiquitin mediated proteolysis ags04141   Protein processing in endoplasmic reticulum ags04310   Wnt signaling pathway ags04341   Hedgehog signaling pathway - fly ags04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:ags00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     114120761    04120 Ubiquitin mediated proteolysis     114120761   09124 Replication and repair    03420 Nucleotide excision repair     114120761  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     114120761    04341 Hedgehog signaling pathway - fly     114120761    04350 TGF-beta signaling pathway     114120761  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ags04121]     114120761    03400 DNA repair and recombination proteins [BR:ags03400]     114120761 Enzymes [BR:ags01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      114120761 Ubiquitin system [BR:ags04121]  Ubiquitin ligases (E3)   UBL E3 ligases    114120761   Multi subunit type E3    SCF complex     Ring finger protein      114120761    Cul2 complex      114120761    Cul3 complex      114120761    Cul4 complex      114120761    Cul7 complex      114120761    Cul8 complex      114120761    Cul9 complex      114120761 DNA repair and recombination proteins [BR:ags03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       114120761     TCR (transcription coupled repair) factors      Cul4-CSA complex       114120761 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  114120761 NCBI-ProteinID:  XP_050054662 LinkDB All DBs Position 1:complement(99813..101695) Genome browser AA seq 110 aa AA seqDB search MEVDEEDVEAPSSSTSSRGEKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQA NQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atggaagttgatgaagaggatgttgaagctccatcatcgagcaccagcagtcgcggagaa aaaaaaagatttgaagtaaagaagtggaatgctgtggctttatgggcttgggacattgtt gtagacaattgtgccatttgtcgtaatcatatcatggacttatgtattgaatgtcaagct aaccaagcatcagctactagtgaagaatgtactgttgcatggggtgtgtgtaatcatgct tttcattttcactgcatatctcgttggttaaaaactcgtcaagtatgcccacttgataat agagaatgggaattccaaaagtacggtcattaa

DBGET integrated database retrieval system