Arachis hypogaea (peanut): 112723633 Help Entry 112723633         CDS       T07294                                  Name (RefSeq) uncharacterized protein   KO K26502   transmembrane protein 258 Organism ahf  Arachis hypogaea (peanut) Pathway ahf00510   N-Glycan biosynthesis ahf00513   Various types of N-glycan biosynthesis ahf04141   Protein processing in endoplasmic reticulum Module ahf_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:ahf00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     112723633    00513 Various types of N-glycan biosynthesis     112723633  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     112723633 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 Motif Other DBs NCBI-GeneID:  112723633 NCBI-ProteinID:  XP_025630850 LinkDB All DBs Position 11:complement(148723267..148725226) Genome browser AA seq 76 aa AA seqDB search MAPKAITSPVPDSLYPTLSVLTLAIGLVLTASFFIYEATTSRKTRSLAQELTTGAVASVF LGFGSLFLLIACGVYV NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggctccgaaagcaataacgagtcctgtcccagattcattgtacccgaccctctccgtt cttactctcgccattggtctcgtcttaactgcatctttcttcatttacgaagcaacaact tcccggaagacccgttcccttgctcaggagctaacaaccggggcagtggcatcagttttc ttgggttttggatccttgttcctcctaattgcttgcggcgtttatgtctga

DBGET integrated database retrieval system