Arachis hypogaea (peanut): 112737543 Help Entry 112737543         CDS       T07294                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism ahf  Arachis hypogaea (peanut) Pathway ahf03420   Nucleotide excision repair ahf04120   Ubiquitin mediated proteolysis ahf04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:ahf00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     112737543    04120 Ubiquitin mediated proteolysis     112737543   09124 Replication and repair    03420 Nucleotide excision repair     112737543  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ahf04121]     112737543    03400 DNA repair and recombination proteins [BR:ahf03400]     112737543 Enzymes [BR:ahf01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      112737543 Ubiquitin system [BR:ahf04121]  Ubiquitin ligases (E3)   UBL E3 ligases    112737543   Multi subunit type E3    SCF complex     Ring finger protein      112737543    Cul2 complex      112737543    Cul3 complex      112737543    Cul4 complex      112737543    Cul7 complex      112737543    Cul8 complex      112737543    Cul9 complex      112737543 DNA repair and recombination proteins [BR:ahf03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       112737543     TCR (transcription coupled repair) factors      Cul4-CSA complex       112737543 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  112737543 NCBI-ProteinID:  XP_025643277 LinkDB All DBs Position 13:18037119..18039585 Genome browser AA seq 117 aa AA seqDB search MATLDSDVPMVPAGEPSSSAAGPSTKKPKRFEIKKWNAVALWAWDIVVDNCAICRNHIMD LCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggcgacacttgattccgatgttcctatggttcccgccggcgagccctccagcagcgcc gccggcccttccaccaagaagcccaaacgcttcgagatcaagaagtggaacgccgttgct ctatgggcttgggatattgttgtggataactgtgccatctgcaggaaccacatcatggat ctctgtatcgagtgccaagctaatcaagctagtgcaactagcgaggaatgcactgtggct tggggggtttgtaaccatgcttttcacttccattgcattagtcgttggctcaagacccgt caagtatgtcctctagataacagtgagtgggaatttcagaaatatggtcactag

DBGET integrated database retrieval system