Arachis hypogaea (peanut): 112771395 Help Entry 112771395         CDS       T07294                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism ahf  Arachis hypogaea (peanut) Pathway ahf03420   Nucleotide excision repair ahf04120   Ubiquitin mediated proteolysis ahf04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:ahf00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     112771395    04120 Ubiquitin mediated proteolysis     112771395   09124 Replication and repair    03420 Nucleotide excision repair     112771395  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ahf04121]     112771395    03400 DNA repair and recombination proteins [BR:ahf03400]     112771395 Enzymes [BR:ahf01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      112771395 Ubiquitin system [BR:ahf04121]  Ubiquitin ligases (E3)   UBL E3 ligases    112771395   Multi subunit type E3    SCF complex     Ring finger protein      112771395    Cul2 complex      112771395    Cul3 complex      112771395    Cul4 complex      112771395    Cul7 complex      112771395    Cul8 complex      112771395    Cul9 complex      112771395 DNA repair and recombination proteins [BR:ahf03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       112771395     TCR (transcription coupled repair) factors      Cul4-CSA complex       112771395 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  112771395 NCBI-ProteinID:  XP_025671908 LinkDB All DBs Position 18:8181839..8183542 Genome browser AA seq 116 aa AA seqDB search MATLDSDVPMVPAGEPSSSAGPSSKKPKRFEIKKWNAVALWAWDIVVDNCAICRNHIMDL CIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggcaactctggactccgacgtaccaatggttccggccggcgagccttccagcagcgcg ggtccttcctccaagaagcccaagcgcttcgagatcaagaaatggaacgctgttgctctc tgggcttgggatatagttgttgataactgcgctatttgccggaaccatatcatggatctc tgcattgagtgccaggctaatcaggctagcgccactagcgaggaatgcactgtagcgtgg ggagtttgcaaccatgcttttcacttccattgcataagcagatggctcaagacccgtcaa gtttgccctctagataatagcgagtgggagtttcagaaatatggccactag

DBGET integrated database retrieval system