Arachis ipaensis: 107613945 Help Entry 107613945         CDS       T04301                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism aip  Arachis ipaensis Pathway aip03420   Nucleotide excision repair aip04120   Ubiquitin mediated proteolysis aip04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:aip00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     107613945    04120 Ubiquitin mediated proteolysis     107613945   09124 Replication and repair    03420 Nucleotide excision repair     107613945  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:aip04121]     107613945    03400 DNA repair and recombination proteins [BR:aip03400]     107613945 Enzymes [BR:aip01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      107613945 Ubiquitin system [BR:aip04121]  Ubiquitin ligases (E3)   UBL E3 ligases    107613945   Multi subunit type E3    SCF complex     Ring finger protein      107613945    Cul2 complex      107613945    Cul3 complex      107613945    Cul4 complex      107613945    Cul7 complex      107613945    Cul8 complex      107613945    Cul9 complex      107613945 DNA repair and recombination proteins [BR:aip03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       107613945     TCR (transcription coupled repair) factors      Cul4-CSA complex       107613945 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  107613945 NCBI-ProteinID:  XP_016171631 LinkDB All DBs Position B08:7316631..7318320 Genome browser AA seq 116 aa AA seqDB search MATLDSDVPMVPAGEPSSSAGPSSKKPKRFEIKKWNAVALWAWDIVVDNCAICRNHIMDL CIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggcaactctggactccgacgtaccaatggttccggccggcgagccttccagcagcgcg ggtccttcctccaagaagcccaagcgcttcgagatcaagaaatggaacgctgttgctctc tgggcttgggatatagttgttgataactgcgctatttgccggaaccatatcatggatctc tgcattgagtgccaggctaatcaggctagcgccactagcgaggaatgcactgtagcgtgg ggagtttgcaaccatgcttttcacttccattgcataagcagatggctcaagacccgtcaa gtttgccctctagataatagcgagtgggagtttcagaaatatggccactag

DBGET integrated database retrieval system