Arachis ipaensis: 107629957 Help Entry 107629957         CDS       T04301                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism aip  Arachis ipaensis Pathway aip03420   Nucleotide excision repair aip04120   Ubiquitin mediated proteolysis aip04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:aip00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     107629957    04120 Ubiquitin mediated proteolysis     107629957   09124 Replication and repair    03420 Nucleotide excision repair     107629957  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:aip04121]     107629957    03400 DNA repair and recombination proteins [BR:aip03400]     107629957 Enzymes [BR:aip01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      107629957 Ubiquitin system [BR:aip04121]  Ubiquitin ligases (E3)   UBL E3 ligases    107629957   Multi subunit type E3    SCF complex     Ring finger protein      107629957    Cul2 complex      107629957    Cul3 complex      107629957    Cul4 complex      107629957    Cul7 complex      107629957    Cul8 complex      107629957    Cul9 complex      107629957 DNA repair and recombination proteins [BR:aip03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       107629957     TCR (transcription coupled repair) factors      Cul4-CSA complex       107629957 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  107629957 NCBI-ProteinID:  XP_016188414 LinkDB All DBs Position B03:17559032..17561396 Genome browser AA seq 117 aa AA seqDB search MATLDSDVPMVPAGEPSSSAAGPSTKKPKRFEIKKWNAVALWAWDIVVDNCAICRNHIMD LCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggcgacacttgattccgatgttcctatggttcccgccggcgagccctccagcagcgcc gccggcccttccaccaagaagcccaaacgcttcgagatcaagaagtggaacgccgttgct ctatgggcttgggatattgttgtggataactgtgccatctgcaggaaccacatcatggat ctctgtatcgagtgccaagctaatcaagctagtgcaactagcgaggaatgcactgtggct tggggggtttgtaaccatgcttttcacttccattgcattagtcgttggctcaagacccgt caagtatgtcctctagataacagtgagtgggaatttcagaaatatggtcactag

DBGET integrated database retrieval system